From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS070
  • pan locus tag?: SAUPAN005468000
  • symbol: SAS070
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAS070
  • symbol: SAS070
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2207165..2207335
  • length: 171
  • essential: no DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGTCGCCTAAAGATACAACAAGATTCGAGACAAAACCTGATCATCAAGCACAGTTTGAC
    TGGAAAGAAAGCATTAACTTTAAAACGAAAGATAATCAAAGGATTCCACTATATATAGGT
    GTGCTACTACTTTATTATTCTCGTTTTATAATCATGCATAACAATGAGTAA
    60
    120
    171

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAS070
  • symbol: SAS070
  • description: hypothetical protein
  • length: 56
  • theoretical pI: 8.99239
  • theoretical MW: 6819.73
  • GRAVY: -0.801786

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107965: hypothetical protein
  • PFAM:
    SAND (CL0831) SAND_ULT1; ULTRAPETALA1 SAND domain (PF23292; HMM-score: 16.3)
    and 2 more
    RNase_H (CL0219) rve; Integrase core domain (PF00665; HMM-score: 12.4)
    SAND (CL0831) SAND; SAND domain (PF01342; HMM-score: 12.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7126
    • Cytoplasmic Membrane Score: 0.191
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0963
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013823
    • TAT(Tat/SPI): 0.000579
    • LIPO(Sec/SPII): 0.005103
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSPKDTTRFETKPDHQAQFDWKESINFKTKDNQRIPLYIGVLLLYYSRFIIMHNNE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]