From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN000541000
  • symbol?:
  • description?: TIGR01741 family protein
  • strand?: +
  • coordinates?: 625015..1484993
  • synteny block?: BlockID0002560
  • occurrence?: in 21% of 33 strains

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    6850:
    71193:
    ECT-R 2:
    ED133:
    SAOV_0251
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_02750
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0319
    VC40:
    SAVC_01255

Genome Viewer[edit | edit source]

NCTC8325
Newman
USA300_FPR3757

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    NCTC8325        MTFEEKLSQMYNEIANEISGMIPVEWENIYTIAYVTDQGGEVIFNYTKPGSDELNYYTYI
    Newman          MTFEEKLSQMYNEIANEISGMIPVEWENIYTIAYVTDQGGEVIFNYTKPGSDELNYYTYI
    USA300_FPR3757  MTFEEKISKLYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTDI
                    ******:*::*********.*******::**:**: * ****:*********:***** *

    NCTC8325        PREYNVSEKVFYDLWTDLYRLFKKLRETFKEEGLEPWTSSEFDFTSEGKLKVSFDYIDWI
    Newman          PREYNVSEKVFYDLWTDLYRLFKKLRETFKEEGLEPWTSSEFDFTSEGKLKVSFDYIDWI
    USA300_FPR3757  PKEYNISVQVFDDLWMDLYDLFEELRDLFKEEGLEPWTSCEFDFTSEGKLKVSFDYIDWI
                    *:***:* :** *** *** **::**: ***********.********************

    NCTC8325        NTEFDQLGRENYYMYKKFGVLPEMEYEMEEVKEIEQYIKEQDEAEL
    Newman          NTEFDQLGRENYYMYKKFGVLPEMEYEMEEVKEIEQYIKEQDEAEL
    USA300_FPR3757  NTEFDQLGRENYYMYKKFGVLPEMEYEMEEIKEIDQYIKEQDEAEI
                    ******************************:***:**********: