From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN000751000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 888962..889063
  • synteny block?: BlockID0003600
  • occurrence?: in 24% of 33 strains

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    6850:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_0078
    JH9:
    SaurJH9_0076
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_00680
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0095
    VC40:
    SAVC_00160

Genome Viewer[edit | edit source]

COL
NCTC8325
USA300_FPR3757

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    COL             MSTRGLNIWQEMEIGNVSHKVAKRAQIPLIIFK
    NCTC8325        MSTRGLNIWQEMEIGNVSHKVAKRAQIPLIIFK
    USA300_FPR3757  MSTRGLNIWQEMEIGNVSHKVAKRAQIPLIIFK
                    *********************************