From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN001210000
  • symbol?:
  • description?: DUF5079 domain-containing protein

      descriptions from strain specific annotations:

    • DUF5079 domain-containing protein
    • putative lipoprotein
    • lipoprotein, putative
    • DUF5079 family protein
  • strand?: +
  • coordinates?: 1480733..1482508
  • synteny block?: BlockID0007220
  • occurrence?: in 55% of 33 strains

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0294
    08BA02176:
    11819-97:
    MS7_0285
    6850:
    RSAU_000240
    71193:
    ECT-R 2:
    ECTR2_255
    ED133:
    ED98:
    SAAV_0262
    HO 5096 0412:
    JH1:
    SaurJH1_0285
    JH9:
    SaurJH9_0278
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_02620
    MSSA476:
    Mu3:
    SAHV_0292
    Mu50:
    SAV0295
    MW2:
    RF122:
    SAB0235
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0309
    VC40:
    SAVC_01225

Genome Viewer[edit | edit source]

COL
N315
NCTC8325
Newman
USA300_FPR3757

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    COL             MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVIS
    N315            MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVIS
    NCTC8325        MTTKENIDTLRKPGAQALSLASLFMILFSCLTFFFGLDYERFPNYLKITTIIELIIIIIS
    Newman          MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVIS
    USA300_FPR3757  MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNYLKITTIIELIIIVIS
                    ******************** ***:********************************:**

    COL             LLQWIRFIDFEKESAQKYKKIYARFLVVINVLTTITVVFALCNLYYFAAVQNHYDLFNYW
    N315            LLQWIRFIDFEKESARKYKKIYARFLVIINVLTTITVVFALCNLYYFAAVQNHYDLFNYW
    NCTC8325        LLQWIRFIDFEKESAQKYKKIYARFLVIINVLTTITAVFATCNLYYFVAVQNHYDLFNYW
    Newman          LLQWIRFIDFEKESAQKYKKIYARFLVVINVLTTITVVFALCNLYYFAAVQNHYDLFNYW
    USA300_FPR3757  LLQWIRFIDFEKESAQKYKKIYARFLVVINVLTTITVVFALCNLYYFAAVQNHYDLFNYW
                    ***************:***********:********.*** ******.************

    COL             LMGSISIIISYLLLVIGGMFTLLKLPKVTKRWGGKTKTHFGLLLTALSSFIYIEKIIEYI
    N315            LMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGKTKTHFGLLLTALSSFIYIEKIIEYI
    NCTC8325        LMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGKTKTHFGLLLTALSSFIYIEKIIEYI
    Newman          LMGSISIIISYLLLVIGGMFTLLKLPKVTKRWGGKTKTHFGLLLTALSSFIYIEKIIEYI
    USA300_FPR3757  LMGSISIIISYLLLVIGGMFTLLKLPKVTKRWGGKTKTHFGLLLTALSSFIYIEKIIEYI
                    ***:********************************************************

    COL             LVPNVVESKFIIIVSMLVIAGAQFVAFQFIMQYSRFYIFELNTEDDD
    N315            LIPNVVESKFIIIVSMLVIAGAQFVAFQFIMQYSRFYIFELNTEDDD
    NCTC8325        LVPNVVESKFIIIVSMLVIAGAQFVAFQFIMQYSRFYIFELNTEDDD
    Newman          LVPNVVESKFIIIVSMLVIAGAQFVAFQFIMQYSRFYIFELNTEDDD
    USA300_FPR3757  LVPNVVESKFIIIVSMLVIAGAQFVAFQFIMQYSRFYIFELNTEDDD
                    *:*********************************************