⊟Summary[edit | edit source]
- pan ID?: SAUPAN004098000
- symbol?: —
- synonym:
- description?: hypothetical protein
- strand?: -
- coordinates?: 4378492..4378875
- synteny block?: BlockID0031280
- occurrence?: in 26% of 34 strains
virB3 : ICE6013 translocase accessory protein VirB3 [1]
Some staphylococci have acquired a Type IV secretion system encoded on an integrative conjugative element (ICE6013), which encodes a minimal conjugative transfer function that may have adapted to double as a small molecule translocation system. Translocase accessory proteins associate with translocase ATPases at the inner leaflet of the cell membrane and are essential for the formation of the translocon channel. Their exact role is unclear but may mediate protein-protein interactions, substrate recognition or proper ATPase orientation. Although these orthologues have not been structurally-confirmed, the entry to the translocon channel typically consists of a hexameric ring of VirB3-VirB4 heterodimers.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
COL | |
USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.307)
COL MDKKAYNLKRTFEQPIVMYEFTDKFRINKGFRLDFWATFLIVWFILFLLFWYLLQPVIMS
USA300_FPR3757 MDKKAYNLKRTFEQPIVMYEFTDKFRINKGFRLDFWATFLIVWFILFLLFWYLLQPVIMS
************************************************************
COL IGGLMFIYFTVAPYYITKYIVKLKQDGKKLFFFLWDFVIFVFNVQLRKVKLSYDEEVEYH
USA300_FPR3757 IGGLMFIYFTVAPYYITKYIVKLKQDGKKLFFFLWDFVIFVFNVQLRKVKLSYDEEVEYH
************************************************************
COL DKKITFK
USA300_FPR3757 DKKITFK
*******
- ↑ Zita Nagy, Mónika Szabó, Michael Chandler, Ferenc Olasz
Analysis of the N-terminal DNA binding domain of the IS30 transposase.
Mol Microbiol: 2004, 54(2);478-88
[PubMed:15469518] [WorldCat.org] [DOI] (P p)Davida S Smyth, D Ashley Robinson
Integrative and sequence characteristics of a novel genetic element, ICE6013, in Staphylococcus aureus.
J Bacteriol: 2009, 191(19);5964-75
[PubMed:19648240] [WorldCat.org] [DOI] (I p)Minny Bhatty, Jenny A Laverde Gomez, Peter J Christie
The expanding bacterial type IV secretion lexicon.
Res Microbiol: 2013, 164(6);620-39
[PubMed:23542405] [WorldCat.org] [DOI] (I p)Emily A Sansevere, Xiao Luo, Joo Youn Park, Sunghyun Yoon, Keun Seok Seo, D Ashley Robinson
Transposase-Mediated Excision, Conjugative Transfer, and Diversity of ICE6013 Elements in Staphylococcus aureus.
J Bacteriol: 2017, 199(8);
[PubMed:28138100] [WorldCat.org] [DOI] (I e)