⊟Summary[edit | edit source]
- pan ID?: SAUPAN004099000
- symbol?: —
- synonym:
- description?: hypothetical protein
- strand?: -
- coordinates?: 4378887..4379147
- synteny block?: BlockID0031290
- occurrence?: in 26% of 34 strains
virB2 : ICE6013 probable pilin subunit VirB2 [1]
Some staphylococci have acquired a Type IV secretion system encoded on an integrative conjugative element (ICE6013), which encodes a minimal conjugative transfer function that may have adapted to double as a small molecule translocation system. Pilin subunits are secreted through the VirB8 channel and self-assemble into a helical mating channel comprising the true extracellular component of the conjugative pilus. Typical VirB2 subunits are synthesized as prepilin subunits requiring proteolytic processing and macrocyclization before they are functional. This orthologue lacks the proteolytic processing signal, is the size of mature pilin and lacks a clear nearby VirB10-like pilin cyclase. However, it is structurally similar to pilin and located between virB8 and virB3 where virB2 prepilin coding sequences are typically found.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
COL | |
USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.307)
COL MSGLFNFFVLGADRPSLGGVGDWISNEVGTGIGLVVLVVGIVKWASGKYGHMVILFVVGG
USA300_FPR3757 MSGLFNFFVLGADRPSLGGVGDWISNEVGTGIGLVVLVVGIVKWASGKYGHMVILFVVGG
************************************************************
COL FLFLVSKGPEQVFNAIAGVWKMIFGG
USA300_FPR3757 FLFLVSKGPEQVFNAIAGVWKMIFGG
**************************
- ↑ Erh-Min Lai, Ralf Eisenbrandt, Markus Kalkum, Erich Lanka, Clarence I Kado
Biogenesis of T pili in Agrobacterium tumefaciens requires precise VirB2 propilin cleavage and cyclization.
J Bacteriol: 2002, 184(1);327-30
[PubMed:11741876] [WorldCat.org] [DOI] (P p)Davida S Smyth, D Ashley Robinson
Integrative and sequence characteristics of a novel genetic element, ICE6013, in Staphylococcus aureus.
J Bacteriol: 2009, 191(19);5964-75
[PubMed:19648240] [WorldCat.org] [DOI] (I p)Minny Bhatty, Jenny A Laverde Gomez, Peter J Christie
The expanding bacterial type IV secretion lexicon.
Res Microbiol: 2013, 164(6);620-39
[PubMed:23542405] [WorldCat.org] [DOI] (I p)Emily A Sansevere, Xiao Luo, Joo Youn Park, Sunghyun Yoon, Keun Seok Seo, D Ashley Robinson
Transposase-Mediated Excision, Conjugative Transfer, and Diversity of ICE6013 Elements in Staphylococcus aureus.
J Bacteriol: 2017, 199(8);
[PubMed:28138100] [WorldCat.org] [DOI] (I e)Tamilarasi Shanmugasundarasamy, Deenadayalan Karaiyagowder Govindarajan, Kumaravel Kandaswamy
A review on pilus assembly mechanisms in Gram-positive and Gram-negative bacteria.
Cell Surf: 2022, 8;100077
[PubMed:35493982] [WorldCat.org] [DOI] (I e)