⊟Summary[edit | edit source]
- pan ID?: SAUPAN004103000
- symbol?: —
- synonym:
- description?: hypothetical protein
- strand?: -
- coordinates?: 4381852..4382172
- synteny block?: BlockID0031330
- occurrence?: in 26% of 34 strains
helP : Ice6013 helicase processivity factor [1]
Some staphylococci have acquired a minimal Type IV secretion system encoded on an integrative conjugative element (ICE6013), which encodes a minimal conjugative transfer function that may have adapted to double as a small molecule translocation system. Helicase processivity factors work in concert with host helicases (i.e. PcrA) to unwind ICE dsDNA distal to the oriT nick during rolling circle replication. Transfer origins are AT-rich regions that are relatively easy to separate into single-stranded sections once nicked. To enable separation past oriT and enable host ssb proteins access to the remainder of the ICE genome requires a processivity factor to both stimulate host helicase activity and assist with melting of GC-rich regions.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| COL | |
| USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
COL MKPVLDIKKTLGQLNFLGVDEKYKYENGERTDKTVYAYKLASQEQGEQITVKTPNKVELD
USA300_FPR3757 MKPVLDIKKTLGQLNFLGVDEKYKYENGERTDKTVYAYKLASQEQGEQITVKTPNKVELD
************************************************************
COL YLQECELVEPDVKMYVQMSGDFGTIAYSWNAEDIKVVGSNSALKQK
USA300_FPR3757 YLQECELVEPDVKMYVQMSGDFGTIAYSWNAEDIKVVGSNSALKQK
**********************************************
- ↑ Zita Nagy, Mónika Szabó, Michael Chandler, Ferenc Olasz
Analysis of the N-terminal DNA binding domain of the IS30 transposase.
Mol Microbiol: 2004, 54(2);478-88
[PubMed:15469518] [WorldCat.org] [DOI] (P p)Davida S Smyth, D Ashley Robinson
Integrative and sequence characteristics of a novel genetic element, ICE6013, in Staphylococcus aureus.
J Bacteriol: 2009, 191(19);5964-75
[PubMed:19648240] [WorldCat.org] [DOI] (I p)Jacob Thomas, Catherine A Lee, Alan D Grossman
A conserved helicase processivity factor is needed for conjugation and replication of an integrative and conjugative element.
PLoS Genet: 2013, 9(1);e1003198
[PubMed:23326247] [WorldCat.org] [DOI] (I p)Minny Bhatty, Jenny A Laverde Gomez, Peter J Christie
The expanding bacterial type IV secretion lexicon.
Res Microbiol: 2013, 164(6);620-39
[PubMed:23542405] [WorldCat.org] [DOI] (I p)Emily A Sansevere, Xiao Luo, Joo Youn Park, Sunghyun Yoon, Keun Seok Seo, D Ashley Robinson
Transposase-Mediated Excision, Conjugative Transfer, and Diversity of ICE6013 Elements in Staphylococcus aureus.
J Bacteriol: 2017, 199(8);
[PubMed:28138100] [WorldCat.org] [DOI] (I e)