From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
  • pan locus tag?: SAUPAN000817000
  • symbol: SAUSA300_0068
  • pan gene symbol?:
  • synonym:
  • product: cadmium-exporting ATPase, truncation

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
  • symbol: SAUSA300_0068
  • product: cadmium-exporting ATPase, truncation
  • replicon: chromosome
  • strand: -
  • coordinates: 76073..76225
  • length: 153
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    TTGCAACAGAACCTATATTTTGCTATAATTATTAAATTAATTGCCTTTGTGTTAGTATTC
    CCTGGATTACTAACACTTTGGTTAGCTGTTCTAAGTGATACAGGTGCAGCAATATTAGTT
    ATATTAAATTCATTACGTTTATTAAAAAAATAA
    60
    120
    153


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
  • symbol: SAUSA300_0068
  • description: cadmium-exporting ATPase, truncation
  • length: 50
  • theoretical pI: 10.6364
  • theoretical MW: 5569.89
  • GRAVY: 1.424

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds cadmium-translocating P-type ATPase (TIGR01512; EC 3.6.3.3; HMM-score: 38.6)
    and 1 more
    heavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 27.9)
  • TheSEED  :
    • Copper-translocating P-type ATPase (EC 3.6.3.4)
    • Lead, cadmium, zinc and mercury transporting ATPase (EC 3.6.3.3) (EC 3.6.3.5)
    Respiration Electron accepting reactions Terminal cytochrome C oxidases  Copper-translocating P-type ATPase (EC 3.6.3.4)
    and 1 more
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Copper homeostasis  Copper-translocating P-type ATPase (EC 3.6.3.4)
  • PFAM:
    no clan defined PDR_assoc; Plant PDR ABC transporter associated (PF08370; HMM-score: 11.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0003
    • Cytoplasmic Membrane Score: 0.9927
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.007
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.030059
    • TAT(Tat/SPI): 0.001014
    • LIPO(Sec/SPII): 0.009578
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MQQNLYFAIIIKLIAFVLVFPGLLTLWLAVLSDTGAAILVILNSLRLLKK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]