Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
- pan locus tag?: SAUPAN000817000
- symbol: SAUSA300_0068
- pan gene symbol?: —
- synonym:
- product: cadmium-exporting ATPase, truncation
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
- symbol: SAUSA300_0068
- product: cadmium-exporting ATPase, truncation
- replicon: chromosome
- strand: -
- coordinates: 76073..76225
- length: 153
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3913774 NCBI
- RefSeq: YP_492787 NCBI
- BioCyc: see SAUSA300_RS14980
- MicrobesOnline: 1291583 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121TTGCAACAGAACCTATATTTTGCTATAATTATTAAATTAATTGCCTTTGTGTTAGTATTC
CCTGGATTACTAACACTTTGGTTAGCTGTTCTAAGTGATACAGGTGCAGCAATATTAGTT
ATATTAAATTCATTACGTTTATTAAAAAAATAA60
120
153
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0068 [new locus tag: SAUSA300_RS14980 ]
- symbol: SAUSA300_0068
- description: cadmium-exporting ATPase, truncation
- length: 50
- theoretical pI: 10.6364
- theoretical MW: 5569.89
- GRAVY: 1.424
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds cadmium-translocating P-type ATPase (TIGR01512; EC 3.6.3.3; HMM-score: 38.6)and 1 moreheavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 27.9)
- TheSEED :
- Copper-translocating P-type ATPase (EC 3.6.3.4)
- Lead, cadmium, zinc and mercury transporting ATPase (EC 3.6.3.3) (EC 3.6.3.5)
Respiration Electron accepting reactions Terminal cytochrome C oxidases Copper-translocating P-type ATPase (EC 3.6.3.4)and 1 more - PFAM: no clan defined PDR_assoc; Plant PDR ABC transporter associated (PF08370; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.030059
- TAT(Tat/SPI): 0.001014
- LIPO(Sec/SPII): 0.009578
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQQNLYFAIIIKLIAFVLVFPGLLTLWLAVLSDTGAAILVILNSLRLLKK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.