Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0127 [new locus tag: SAUSA300_RS00660 ]
- pan locus tag?: SAUPAN000926000
- symbol: SAUSA300_0127
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0127 [new locus tag: SAUSA300_RS00660 ]
- symbol: SAUSA300_0127
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 145877..146284
- length: 408
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913029 NCBI
- RefSeq: YP_492844 NCBI
- BioCyc: see SAUSA300_RS00660
- MicrobesOnline: 1291642 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAGCTCAATTATAGGAAAAATAGCAATTTGGATAGGCATCGTAGCTCAAATATATTTT
AGTGTCGTTTTTGTTAGGATGATATCTATTAATATTGCTGGAGGATCTGATTACGAAACA
ATTTTTTTATTAGGATTAATATTGGCTCTTTTCACTGTTTTACCAACCATCTTTACTGCG
ATTTATATGGAAAGTTACTCTGTAATCGGAGGTGCACTTTTTATTGTTTATGCTATTATT
GCACTGTGTTTATATAATTTCCTTTCGTCAATTTTATGGCTGATTGGTGGTATTTTGCTG
ATTTGGAATAAATACTCAAAAGATGAATCGACAGACGAAAATGAAAAAGTTGATATTGAA
AGTACAGAGAATCAATTTGAATCTAAAGATAAAATCACTAAAGAATAA60
120
180
240
300
360
408
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0127 [new locus tag: SAUSA300_RS00660 ]
- symbol: SAUSA300_0127
- description: hypothetical protein
- length: 135
- theoretical pI: 4.18191
- theoretical MW: 15122.7
- GRAVY: 0.757037
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107877: hypothetical protein
- PFAM: no clan defined DUF6709; Family of unknown function (DUF6709) (PF20456; HMM-score: 17.8)Peroxisome (CL0484) Reticulon; Reticulon (PF02453; HMM-score: 15.3)and 4 moreno clan defined DUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 14)Herpes_LMP1; Herpesvirus latent membrane protein 1 (LMP1) (PF05297; HMM-score: 8.5)DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 8.1)FUSC (CL0307) FUSC-like; FUSC-like inner membrane protein yccS (PF12805; HMM-score: 5.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9802
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0196
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00521
- TAT(Tat/SPI): 0.000162
- LIPO(Sec/SPII): 0.007829
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSSIIGKIAIWIGIVAQIYFSVVFVRMISINIAGGSDYETIFLLGLILALFTVLPTIFTAIYMESYSVIGGALFIVYAIIALCLYNFLSSILWLIGGILLIWNKYSKDESTDENEKVDIESTENQFESKDKITKE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]