Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0178 [new locus tag: SAUSA300_RS00935 ]
- pan locus tag?: SAUPAN001014000
- symbol: SAUSA300_0178
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0178 [new locus tag: SAUSA300_RS00935 ]
- symbol: SAUSA300_0178
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 200075..200434
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915042 NCBI
- RefSeq: YP_492892 NCBI
- BioCyc: see SAUSA300_RS00935
- MicrobesOnline: 1291693 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGAATACTATAGATACGCATACTAAAGAACAACAATTCTCGAATCTAGTAAGATCTTAT
CGTAAAGAATACGTGGGTAAAGGACCCAATAGTATTCGAGTGTCGTTTAAAGATAATTGG
GCGATTGCACATATGACAGGTGTTTTGAGTAAAGTTGAGAGTTTTTACCTAAACGACAAA
CGCAATGAATCGATGCTCCATTATACACGCACAGAGAAGATTAAACAGATGTATAAAGAA
ATAGATGTAAATGAGATGGAAAGTCTTGTAGGCGCTAAGTTTGTAAAATTATTTACAGAT
ATTGATTTGAATGATGATGAAGTCATTTCAATATTTGTTTTCGATAAGTCAATAGAATAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0178 [new locus tag: SAUSA300_RS00935 ]
- symbol: SAUSA300_0178
- description: hypothetical protein
- length: 119
- theoretical pI: 6.26459
- theoretical MW: 13979.8
- GRAVY: -0.536134
⊟Function[edit | edit source]
- TIGRFAM: conserved hypothetical protein (TIGR01741; HMM-score: 15.5)
- TheSEED :
- FIG01108230: hypothetical protein
- PFAM: no clan defined MpsC; Na+-translocating membrane potential-generating system (MpsC) (PF10057; HMM-score: 103)and 2 moreDUF3269; Protein of unknown function (DUF3269) (PF11673; HMM-score: 14.1)APO_RNA-bind; APO RNA-binding (PF05634; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8819
- Cytoplasmic Membrane Score: 0.06
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.0572
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00786
- TAT(Tat/SPI): 0.000484
- LIPO(Sec/SPII): 0.001576
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNTIDTHTKEQQFSNLVRSYRKEYVGKGPNSIRVSFKDNWAIAHMTGVLSKVESFYLNDKRNESMLHYTRTEKIKQMYKEIDVNEMESLVGAKFVKLFTDIDLNDDEVISIFVFDKSIE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]