From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0725 [new locus tag: SAUSA300_RS03905 ]
  • pan locus tag?: SAUPAN002647000
  • symbol: SAUSA300_0725
  • pan gene symbol?: brxC
  • synonym: ytxJ
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0725 [new locus tag: SAUSA300_RS03905 ]
  • symbol: SAUSA300_0725
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 805224..805544
  • length: 321
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    GTGGCTATAAAGCTAAGTTCAATTGACCAATTTGAACAGGTTATTGAGGAAAATAAATAT
    GTTTTTGTATTAAAACATAGTGAAACTTGTCCAATATCGGCAAATGCGTACGATCAATTT
    AATAAATTTTTATATGAACGCGATATGGACGGTTATTATTTGATTGTCCAACAAGAACGC
    GATTTGTCAGATTATATTGCTAAAAAAACGAACGTTAAACATGAATCACCTCAAGCATTT
    TATTTTGTAAATGGTGAAATGGTTTGGAATCGAGACCACGGTGATATCAATGTGTCGTCA
    TTAGCACAAGCAGAAGAATAA
    60
    120
    180
    240
    300
    321


⊟Protein[edit | edit source]

Protein Data Bank: 3IV4

⊟General[edit | edit source]

  • locus tag: SAUSA300_0725 [new locus tag: SAUSA300_RS03905 ]
  • symbol: SAUSA300_0725
  • description: hypothetical protein
  • length: 106
  • theoretical pI: 4.44331
  • theoretical MW: 12436.8
  • GRAVY: -0.557547

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function Enzymes of unknown specificity bacillithiol system protein YtxJ (TIGR04019; HMM-score: 111.4)
  • TheSEED  :
    • Uncharacterized protein YtxJ
  • PFAM:
    Thioredoxin (CL0172) BrxC; Monothiol bacilliredoxin BrxC (PF11009; HMM-score: 114.6)
    and 4 more
    no clan defined HHA; Haemolysin expression modulating protein (PF05321; HMM-score: 15.7)
    GBD (CL0202) CBM_11; Carbohydrate binding domain (family 11) (PF03425; HMM-score: 14.4)
    no clan defined HI_0552; HI_0552 protein family (PF10786; HMM-score: 14.4)
    DUF2977; Protein of unknown function (DUF2977) (PF11192; HMM-score: 14.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9543
    • Cytoplasmic Membrane Score: 0.0099
    • Cell wall & surface Score: 0.0026
    • Extracellular Score: 0.0332
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005812
    • TAT(Tat/SPI): 0.000316
    • LIPO(Sec/SPII): 0.000877
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQERDLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_0725&oldid=141925"