Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
- pan locus tag?: SAUPAN002849000
- symbol: SAUSA300_0805
- pan gene symbol?: —
- synonym:
- product: pathogenicity island protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
- symbol: SAUSA300_0805
- product: pathogenicity island protein
- replicon: chromosome
- strand: +
- coordinates: 886052..886324
- length: 273
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3913383 NCBI
- RefSeq: YP_493505 NCBI
- BioCyc: see SAUSA300_RS04345
- MicrobesOnline: 1292320 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTCTAGAACAAAATTGCATGATGTACCAGCTAAAGAAAATACAATTACAGAACCAAAG
CAAGTTGTAGTGAATCCTTTGTTTGCGAAACCTAATGCACTAGCTAGTATTTTGGGAATT
TCATATAGTTCGGTGAATCGCATTTTAAAAGAGTGGGAAAAAGATTCTAAAGGTGTTGAT
GATTTATATTACTCGTTATCATCAACAATGATTGTTATCAGTATTCCGCGATTCGAGGAG
TACATGAAGGCGCGTCATAAAAAATGGATGTAG60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
- symbol: SAUSA300_0805
- description: pathogenicity island protein
- length: 90
- theoretical pI: 9.97772
- theoretical MW: 10371
- GRAVY: -0.364444
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)
- TheSEED :
- Hypothetical SAR0369 homolog in superantigen-encoding pathogenicity islands SaPI
- PFAM: HTH (CL0123) HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 20.6)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.9)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 17.4)and 7 moreMarR_2; MarR family (PF12802; HMM-score: 15.4)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 13.8)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.7)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 13.3)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.3)HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 13.2)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9772
- Cytoplasmic Membrane Score: 0.0045
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0179
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010666
- TAT(Tat/SPI): 0.001341
- LIPO(Sec/SPII): 0.001171
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSRTKLHDVPAKENTITEPKQVVVNPLFAKPNALASILGISYSSVNRILKEWEKDSKGVDDLYYSLSSTMIVISIPRFEEYMKARHKKWM
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]