From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
  • pan locus tag?: SAUPAN002849000
  • symbol: SAUSA300_0805
  • pan gene symbol?:
  • synonym:
  • product: pathogenicity island protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
  • symbol: SAUSA300_0805
  • product: pathogenicity island protein
  • replicon: chromosome
  • strand: +
  • coordinates: 886052..886324
  • length: 273
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTCTAGAACAAAATTGCATGATGTACCAGCTAAAGAAAATACAATTACAGAACCAAAG
    CAAGTTGTAGTGAATCCTTTGTTTGCGAAACCTAATGCACTAGCTAGTATTTTGGGAATT
    TCATATAGTTCGGTGAATCGCATTTTAAAAGAGTGGGAAAAAGATTCTAAAGGTGTTGAT
    GATTTATATTACTCGTTATCATCAACAATGATTGTTATCAGTATTCCGCGATTCGAGGAG
    TACATGAAGGCGCGTCATAAAAAATGGATGTAG
    60
    120
    180
    240
    273


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
  • symbol: SAUSA300_0805
  • description: pathogenicity island protein
  • length: 90
  • theoretical pI: 9.97772
  • theoretical MW: 10371
  • GRAVY: -0.364444

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)
  • TheSEED  :
    • Hypothetical SAR0369 homolog in superantigen-encoding pathogenicity islands SaPI
    Phages, Prophages, Transposable elements, Plasmids Pathogenicity islands Staphylococcal pathogenicity islands SaPI  Hypothetical SAR0369 homolog in superantigen-encoding pathogenicity islands SaPI
  • PFAM:
    HTH (CL0123) HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 20.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.9)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 17.4)
    and 7 more
    MarR_2; MarR family (PF12802; HMM-score: 15.4)
    HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 13.8)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.7)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 13.3)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.3)
    HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 13.2)
    HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9772
    • Cytoplasmic Membrane Score: 0.0045
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0179
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.83
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010666
    • TAT(Tat/SPI): 0.001341
    • LIPO(Sec/SPII): 0.001171
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSRTKLHDVPAKENTITEPKQVVVNPLFAKPNALASILGISYSSVNRILKEWEKDSKGVDDLYYSLSSTMIVISIPRFEEYMKARHKKWM

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]