PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
• pan locus tag^?: SAUPAN002849000
• symbol: SAUSA300_0805
• pan gene symbol^?: —
• synonym:
• product: pathogenicity island protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
• symbol: SAUSA300_0805
• product: pathogenicity island protein
• replicon: chromosome
• strand: +
• coordinates: 886052..886324
• length: 273
• essential: unknown

⊟Accession numbers

• Gene ID: 3913383 NCBI
• RefSeq: YP_493505 NCBI
• BioCyc: see SAUSA300_RS04345
• MicrobesOnline: 1292320 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  
  ATGTCTAGAACAAAATTGCATGATGTACCAGCTAAAGAAAATACAATTACAGAACCAAAG
  CAAGTTGTAGTGAATCCTTTGTTTGCGAAACCTAATGCACTAGCTAGTATTTTGGGAATT
  TCATATAGTTCGGTGAATCGCATTTTAAAAGAGTGGGAAAAAGATTCTAAAGGTGTTGAT
  GATTTATATTACTCGTTATCATCAACAATGATTGTTATCAGTATTCCGCGATTCGAGGAG
  TACATGAAGGCGCGTCATAAAAAATGGATGTAG
  60
  120
  180
  240
  273
  

⊟Protein

⊟General

• locus tag: SAUSA300_0805 [new locus tag: SAUSA300_RS04345 ]
• symbol: SAUSA300_0805
• description: pathogenicity island protein
• length: 90
• theoretical pI: 9.97772
• theoretical MW: 10371
• GRAVY: -0.364444

⊟Function

• TIGRFAM:
  Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)
  Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)
  Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 12.9)
• TheSEED  :
  • Hypothetical SAR0369 homolog in superantigen-encoding pathogenicity islands SaPI
  Phages, Prophages, Transposable elements, Plasmids Pathogenicity islands Staphylococcal pathogenicity islands SaPI  Hypothetical SAR0369 homolog in superantigen-encoding pathogenicity islands SaPI
• PFAM:
  HTH (CL0123) HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 21.2)
  HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19)
  HTH_29; Winged helix-turn helix (PF13551; HMM-score: 18.4)
  and 8 more
  HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 14.2)
  HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.9)
  Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 13.4)
  HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 13.3)
  MarR_2; MarR family (PF12802; HMM-score: 13)
  Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 12.6)
  HTH_10; HTH DNA binding domain (PF04967; HMM-score: 12.2)
  HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.2)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: unknown (no significant prediction)
  • Cytoplasmic Score: 2.5
  • Cytoplasmic Membrane Score: 2.5
  • Cellwall Score: 2.5
  • Extracellular Score: 2.5
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 0.83
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.010666
  • TAT(Tat/SPI): 0.001341
  • LIPO(Sec/SPII): 0.001171
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 87160119 NCBI
• RefSeq: YP_493505 NCBI
• UniProt: A0A0H2XDW8 UniProt

⊟Protein sequence

• MSRTKLHDVPAKENTITEPKQVVVNPLFAKPNALASILGISYSSVNRILKEWEKDSKGVDDLYYSLSSTMIVISIPRFEEYMKARHKKWM

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SAUSA300_0804 > SAUSA300_0805

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications