From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0816 [new locus tag: SAUSA300_RS04400 ]
  • pan locus tag?: SAUPAN002892000
  • symbol: SAUSA300_0816
  • pan gene symbol?:
  • synonym:
  • product: CsbD-like superfamily protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0816 [new locus tag: SAUSA300_RS04400 ]
  • symbol: SAUSA300_0816
  • product: CsbD-like superfamily protein
  • replicon: chromosome
  • strand: +
  • coordinates: 896163..896357
  • length: 195
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAAT
    GTTACTGATAATAAAAATTTAGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCG
    AAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATTTTATTGATAAAGTAAAAGGT
    AACAAAGGCGAGTAA
    60
    120
    180
    195


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0816 [new locus tag: SAUSA300_RS04400 ]
  • symbol: SAUSA300_0816
  • description: CsbD-like superfamily protein
  • length: 64
  • theoretical pI: 4.86657
  • theoretical MW: 7018.64
  • GRAVY: -1.35781

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Uncharacterized UPF0337 protein
  • PFAM:
    YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 58.8)
    and 3 more
    no clan defined MT0933_antitox; MT0933-like antitoxin protein (PF14013; HMM-score: 16.3)
    YtxH; YtxH-like protein (PF12732; HMM-score: 15.2)
    HSP9_HSP12; Heat shock protein 9/12 (PF04119; HMM-score: 14.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.5397
    • Cytoplasmic Membrane Score: 0.0027
    • Cell wall & surface Score: 0.1426
    • Extracellular Score: 0.315
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.015799
    • TAT(Tat/SPI): 0.00346
    • LIPO(Sec/SPII): 0.005712
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]