From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0843 [new locus tag: SAUSA300_RS04555 ]
  • pan locus tag?: SAUPAN003039000
  • symbol: SAUSA300_0843
  • pan gene symbol?: sufA
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0843 [new locus tag: SAUSA300_RS04555 ]
  • symbol: SAUSA300_0843
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 921124..921483
  • length: 360
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCCAACAGTTATATTAACAGAAGCAGCTGCTTACGAAGTAAAAGATATGCTTAAAGCA
    AATGAAATGCCAGATGGCTATTTAAAAATTAAAGTGAATGGTGGCGGGTGCACTGGTTTA
    ACATACGGTATGGGTGCAGAAGAAGCGCCTGGTGAAAATGATGAAGTCTTAGAATACTTT
    GGATTAAAAGTATTAGTAGACAAAAAAGATGCACCCGTATTAAATGGTACGACTATTGAT
    TTTAAGCAATCATTAATGGGTGGCGGTTTCCAAATCGACAATCCTAATGCAATTGCTTCA
    TGTGGCTGTGGTAGTTCATTTAGAACTGCAAAAGTTGCAGGTAATCCTGAAAATTGCTAA
    60
    120
    180
    240
    300
    360

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_0843 [new locus tag: SAUSA300_RS04555 ]
  • symbol: SAUSA300_0843
  • description: hypothetical protein
  • length: 119
  • theoretical pI: 4.25843
  • theoretical MW: 12485.1
  • GRAVY: -0.160504

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly accessory protein (TIGR00049; HMM-score: 112.5)
    and 4 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly scaffold SufA (TIGR01997; HMM-score: 82.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster assembly protein IscA (TIGR02011; HMM-score: 69)
    Unknown function General HesB-like selenoprotein (TIGR01911; HMM-score: 41.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other IscR-regulated protein YhgI (TIGR03341; HMM-score: 29)
  • TheSEED  :
    • Probable iron-binding protein from the HesB_IscA_SufA family
  • PFAM:
    no clan defined Fe-S_biosyn; Iron-sulphur cluster biosynthesis (PF01521; HMM-score: 63.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.83
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.123965
    • TAT(Tat/SPI): 0.000728
    • LIPO(Sec/SPII): 0.004207
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYFGLKVLVDKKDAPVLNGTTIDFKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

One of three iron-sulfur cluster carrier proteins (Nfu, SufA and SufT) that can transfer preformed Fe-S clusters to staphylococcal proteins that require Fe-S clusters to function. Although they are partially functionally-redundant, each has a preferred target enzyme (Nfu is preferred in vivo to generate holo-aconitase while SufT is preferred to generate holo-LipA). By altering the relative amount of each carrier protein, the cell can control which target enzymes receive Fe-S clusters when resources are limited.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

[1]

  1. ↑ Zuelay Rosario-Cruz, Harsimranjit K Chahal, Laura A Mike, Eric P Skaar, Jeffrey M Boyd
    Bacillithiol has a role in Fe-S cluster biogenesis in Staphylococcus aureus.
    Mol Microbiol: 2015, 98(2);218-42
    [PubMed:26135358] [WorldCat.org] [DOI] (I p)    Ameya A Mashruwala, Christina A Roberts, Shiven Bhatt, Kerrie L May, Ronan K Carroll, Lindsey N Shaw, Jeffrey M Boyd
    Staphylococcus aureus SufT: an essential iron-sulphur cluster assembly factor in cells experiencing a high-demand for lipoic acid.
    Mol Microbiol: 2016, 102(6);1099-1119
    [PubMed:27671355] [WorldCat.org] [DOI] (I p)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_0843&oldid=104082"