From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0956 [new locus tag: SAUSA300_RS05140 ]
  • pan locus tag?: SAUPAN003261000
  • symbol: SAUSA300_0956
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0956 [new locus tag: SAUSA300_RS05140 ]
  • symbol: SAUSA300_0956
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1048217..1048651
  • length: 435
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTTTCAAAAGTAAACAATCAAAAGATGTTAGAAGATTGCTTCTATATAAGAAAGAAA
    GTGTTTGTAGAAGAACAAGGCGTCCCTGAGGAAAGTGAAATTGATGAATATGAATCTGAA
    TCTATTCACCTCATTGGATATGATAATGGACAGCCAGTTGCCACTGCTCGAATACGCCCT
    ATTAATGAAACAACTGTCAAAATAGAACGAGTAGCTGTGATGAAATCACATCGTGGACAA
    GGAATGGGTAGAATGCTTATGCAAGCTGTAGAATCATTAGCTAAAGATGAAGGTTTTTAC
    GTAGCTACTATGAATGCCCAATGTCATGCTATCCCATTTTATGAAAGTTTAAACTTTAAA
    ATGAGAGGTAATATATTTCTTGAGGAAGGCATCGAGCATATTGAAATGACAAAAAAGTTA
    ACCTCGCTTAATTAA
    60
    120
    180
    240
    300
    360
    420
    435

Protein[edit | edit source]

Protein Data Bank: 5JPH
Protein Data Bank: 5JQ4

General[edit | edit source]

  • locus tag: SAUSA300_0956 [new locus tag: SAUSA300_RS05140 ]
  • symbol: SAUSA300_0956
  • description: hypothetical protein
  • length: 144
  • theoretical pI: 5.30054
  • theoretical MW: 16555.9
  • GRAVY: -0.405556

Function[edit | edit source]

  • TIGRFAM:
    putative N-acetyltransferase, MSMEG_0567 N-terminal domain family (TIGR04045; HMM-score: 38.8)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 31.4)
    and 5 more
    N-acyl amino acid synthase, PEP-CTERM/exosortase system-associated (TIGR03694; EC 2.3.1.-; HMM-score: 17.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides TDP-D-fucosamine acetyltransferase (TIGR02382; HMM-score: 15.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs mycothiol synthase (TIGR03448; EC 2.3.1.189; HMM-score: 15.3)
    Cellular processes Cellular processes Adaptations to atypical conditions diaminobutyrate acetyltransferase (TIGR02406; EC 2.3.1.178; HMM-score: 14.5)
    putative beta-lysine N-acetyltransferase (TIGR03827; EC 2.3.1.-; HMM-score: 12.5)
  • TheSEED  :
    • GNAT family acetyltransferase YjcF
    Experimental tye  GNAT family acetyltransferase YjcF
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 80.7)
    and 6 more
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 59.4)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 44.6)
    Acetyltransf_9; Acetyltransferase (GNAT) domain (PF13527; HMM-score: 27.6)
    Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 26.5)
    Acetyltransf_5; Acetyltransferase (GNAT) domain (PF13444; HMM-score: 23.4)
    FR47; FR47-like protein (PF08445; HMM-score: 20.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003957
    • TAT(Tat/SPI): 0.000261
    • LIPO(Sec/SPII): 0.000439
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIERVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCHAIPFYESLNFKMRGNIFLEEGIEHIEMTKKLTSLN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SAUSA300_0532(fusA)elongation factor G  [1] (data from MRSA252)
    SAUSA300_0756(gap)glyceraldehyde-3-phosphate dehydrogenase, type I  [1] (data from MRSA252)
    SAUSA300_2203(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    SAUSA300_2171(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]