From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0969 [new locus tag: SAUSA300_RS05210 ]
  • pan locus tag?: SAUPAN003280000
  • symbol: purS
  • pan gene symbol?: purS
  • synonym:
  • product: phosphoribosylformylglycinamidine synthase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0969 [new locus tag: SAUSA300_RS05210 ]
  • symbol: purS
  • product: phosphoribosylformylglycinamidine synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1061748..1062011
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAACAATTGAACTACATATCACATTACAACCACAAGTATTAGATACGCAAGGACAA
    ACGCTTACTCGAGCTGTACATGACTTAGGTTATGCACAAGTGAATGATATTCGTGTAGGA
    AAAGTATTATATATGACAGTGGATGAGGTTAGTGATGAAAAGGTACACAACATTATTACA
    ACTCTAAGTGAAAAATTGTTTGCAAATACAGTGATTGAAGAATATAGCTATAAAGTGTTA
    GATGATGAAAAGGAGAATGCATAA
    60
    120
    180
    240
    264


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0969 [new locus tag: SAUSA300_RS05210 ]
  • symbol: PurS
  • description: phosphoribosylformylglycinamidine synthase
  • length: 87
  • theoretical pI: 4.46527
  • theoretical MW: 9921.15
  • GRAVY: -0.295402

Function[edit | edit source]

  • reaction:
    EC 6.3.5.3?  ExPASy
    Phosphoribosylformylglycinamidine synthase ATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase, purS protein (TIGR00302; HMM-score: 73.1)
  • TheSEED  :
    • Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)
    Nucleosides and Nucleotides Purines De Novo Purine Biosynthesis  Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)
  • PFAM:
    no clan defined PurS; Phosphoribosylformylglycinamidine (FGAM) synthase (PF02700; HMM-score: 81.1)
    and 2 more
    T3RM_EcoP15I_C; Type III R-M EcoP15I C-terminal domain (PF18273; HMM-score: 14.9)
    DUF3333; Domain of unknown function (DUF3333) (PF11812; HMM-score: 14.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9981
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0013
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006483
    • TAT(Tat/SPI): 0.000384
    • LIPO(Sec/SPII): 0.000822
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVLDDEKENA

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]