Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1084 [new locus tag: SAUSA300_RS05875 ]
- pan locus tag?: SAUPAN003461000
- symbol: SAUSA300_1084
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1084 [new locus tag: SAUSA300_RS05875 ]
- symbol: SAUSA300_1084
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1185036..1185326
- length: 291
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914880 NCBI
- RefSeq: YP_493781 NCBI
- BioCyc: see SAUSA300_RS05875
- MicrobesOnline: 1292599 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGATATAAATGTGCTAGCTACAATATTTAAATTCATCCTTTTTGTTGTTGAAATTTAT
TATTTCGGCATGATTATATATTTCTTTACATCTTGGGTACCAAGTATTAGAGAAACTAAG
GTAGGTTATTTTTTAGCGAAAATATATGAACCTTTCTTACAACCATTTAGAAAAGTAATT
CCACCTATTGGAATTATCGACATATCATCAATCGCTGCAATTATCGTTTTAGTATTATTC
CAAAAAGGGTTACTCCAAATCTTTAATTGGATTTTAATTCAATTACAATAA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1084 [new locus tag: SAUSA300_RS05875 ]
- symbol: SAUSA300_1084
- description: hypothetical protein
- length: 96
- theoretical pI: 9.44734
- theoretical MW: 11251.6
- GRAVY: 1.09583
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Cell division integral membrane protein, YggT and half-length relatives
- PFAM: no clan defined YGGT; YGGT family (PF02325; HMM-score: 64.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9978
- Cell wall & surface Score: 0
- Extracellular Score: 0.0021
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 0
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004448
- TAT(Tat/SPI): 0.00029
- LIPO(Sec/SPII): 0.002958
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDINVLATIFKFILFVVEIYYFGMIIYFFTSWVPSIRETKVGYFLAKIYEPFLQPFRKVIPPIGIIDISSIAAIIVLVLFQKGLLQIFNWILIQLQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAUSA300_1081 > SAUSA300_1082 > SAUSA300_1083 > SAUSA300_1084 > SAUSA300_1085 > SAUSA300_1086
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]