From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1249 [new locus tag: SAUSA300_RS06780 ]
  • pan locus tag?: SAUPAN003740000
  • symbol: SAUSA300_1249
  • pan gene symbol?: plsY
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1249 [new locus tag: SAUSA300_RS06780 ]
  • symbol: SAUSA300_1249
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1371362..1371970
  • length: 609
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATGATAATCGTCATGTTACTACTAAGTTATCTTATCGGCGCTTTCCCAAGTGGATTC
    GTAATTGGAAAATTATTTTTCAAAAAAGATATTAGACAATTTGGTAGTGGTAATACTGGC
    GCTACTAATAGCTTTAGAGTATTAGGTCGTCCTGCAGGATTCTTGGTAACATTTCTAGAT
    ATTTTCAAAGGGTTCATAACTGTTTTCTTCCCTTTATGGTTACAAGTTCACGCAGATGGC
    CCTATTAGTACTTTTTTTACAAATGGTTTAATTGTTGGCTTATTCGCTATACTTGGACAC
    GTTTATCCTGTTTATTTAAAATTCCAAGGTGGCAAAGCTGTTGCAACTAGTGCAGGTGTC
    GTCTTGGGAGTCAATCCGATACTTTTACTAATACTTGCAATTATCTTCTTTATTGTATTG
    AAGATTTTTAAATATGTTTCTTTAGCAAGTATCGTTGCAGCAATTTGCTGTGTGATTGGC
    TCGCTTATCATTCAAGACTATATTTTATTAGTCGTTAGTTTCTTAGTTTCAATCATATTG
    ATAATTAGACATCGCTCTAATATCGCAAGGATTTTTAGAGGCGAAGAACCTAAAATAAAA
    TGGATGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    609

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1249 [new locus tag: SAUSA300_RS06780 ]
  • symbol: SAUSA300_1249
  • description: hypothetical protein
  • length: 202
  • theoretical pI: 10.6347
  • theoretical MW: 22262.9
  • GRAVY: 1.15792

Function[edit | edit source]

  • reaction:
    EC 2.3.1.n3?  ExPASy
    Glycerol-3-phosphate acyltransferase (acyl-phosphate transferring) Acyl-phosphate + sn-glycerol 3-phosphate = 1-acyl-sn-glycerol 3-phosphate + phosphate
  • TIGRFAM:
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis acyl-phosphate glycerol 3-phosphate acyltransferase (TIGR00023; EC 2.3.1.-; HMM-score: 200)
  • TheSEED:  
    Fatty Acids, Lipids, and Isoprenoids Phospholipids Glycerolipid and Glycerophospholipid Metabolism in Bacteria  Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY
  • PFAM:
    no clan defined G3P_acyltransf; Glycerol-3-phosphate acyltransferase (PF02660; HMM-score: 178.5)
    and 1 more
    DUF2684; Protein of unknown function (DUF2684) (PF10885; HMM-score: 17)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.047773
    • TAT(Tat/SPI): 0.000894
    • LIPO(Sec/SPII): 0.040964
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGATNSFRVLGRPAGFLVTFLDIFKGFITVFFPLWLQVHADGPISTFFTNGLIVGLFAILGHVYPVYLKFQGGKAVATSAGVVLGVNPILLLILAIIFFIVLKIFKYVSLASIVAAICCVIGSLIIQDYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAUSA300_1249 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]