Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1325
- pan locus tag?: SAUPAN003868000
- symbol: SAUSA300_1325
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1325
- symbol: SAUSA300_1325
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1455875..1456006
- length: 132
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3912972 NCBI
- RefSeq: YP_494022 NCBI
- BioCyc: GH3C-1320 BioCyc
- MicrobesOnline: 1292840 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121GTGGGTCCCAACACAGAAGATGACGAAAAGTCAGCTTACAATAATGTGCAAGTTTGGGAT
GGGCCCCAACAAAGAGAAATTGGATTCCCAATTTCTACAGACAATGCAAGTTGGGGTGGG
ACGACGAAATAA60
120
132
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1325
- symbol: SAUSA300_1325
- description: hypothetical protein
- length: 43
- theoretical pI: 3.93882
- theoretical MW: 4742
- GRAVY: -1.17907
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.252762
- TAT(Tat/SPI): 0.027586
- LIPO(Sec/SPII): 0.039794
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGPNTEDDEKSAYNNVQVWDGPQQREIGFPISTDNASWGGTTK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SAUSA300_1325 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]