From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1373 [new locus tag: SAUSA300_RS07500 ]
  • pan locus tag?: SAUPAN003949000
  • symbol: SAUSA300_1373
  • pan gene symbol?: fer
  • synonym:
  • product: ferredoxin

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1373 [new locus tag: SAUSA300_RS07500 ]
  • symbol: SAUSA300_1373
  • product: ferredoxin
  • replicon: chromosome
  • strand: +
  • coordinates: 1541133..1541357
  • length: 225
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGATACTTGTATTGCATGTGGTGCATGCGGTGCAGCAGCGCCAGATATATATGATTAC
    GACGACGAAGGTATTGCTTTCGTAATCCTTGACGATAACCAAGGTACTGCAGAAGTACCT
    GAGGAATTATATGAAGATATGGAAGATGCAATTGATGGATGCCCTACAGATTCTATTAAA
    ATTGCAGACGAATCATTTGATGGGGACGCTTTAAAATTTGAATAA
    60
    120
    180
    225

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_1373 [new locus tag: SAUSA300_RS07500 ]
  • symbol: SAUSA300_1373
  • description: ferredoxin
  • length: 74
  • theoretical pI: 3.12002
  • theoretical MW: 7918.51
  • GRAVY: -0.204054

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Central intermediary metabolism Sulfur metabolism sulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 10.7)
  • TheSEED  :
    • [4Fe-4S] ferredoxin
    Respiration Respiration - no subcategory Soluble cytochromes and functionally related electron carriers  Ferredoxin
  • PFAM:
    4Fe-4S (CL0344) Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 76.8)
    and 4 more
    Fer4_15; 4Fe-4S single cluster domain (PF13459; HMM-score: 49.1)
    Fer4; 4Fe-4S binding domain (PF00037; HMM-score: 14.7)
    Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 14.6)
    Fer4_19; Divergent 4Fe-4S mono-cluster (PF06902; HMM-score: 14.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.031143
    • TAT(Tat/SPI): 0.000364
    • LIPO(Sec/SPII): 0.002564
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAIDGCPTDSIKIADESFDGDALKFE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_1373&oldid=97523"