Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1373 [new locus tag: SAUSA300_RS07500 ]
- pan locus tag?: SAUPAN003949000
- symbol: SAUSA300_1373
- pan gene symbol?: fer
- synonym:
- product: ferredoxin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1373 [new locus tag: SAUSA300_RS07500 ]
- symbol: SAUSA300_1373
- product: ferredoxin
- replicon: chromosome
- strand: +
- coordinates: 1541133..1541357
- length: 225
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913532 NCBI
- RefSeq: YP_494070 NCBI
- BioCyc: see SAUSA300_RS07500
- MicrobesOnline: 1292888 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGATACTTGTATTGCATGTGGTGCATGCGGTGCAGCAGCGCCAGATATATATGATTAC
GACGACGAAGGTATTGCTTTCGTAATCCTTGACGATAACCAAGGTACTGCAGAAGTACCT
GAGGAATTATATGAAGATATGGAAGATGCAATTGATGGATGCCCTACAGATTCTATTAAA
ATTGCAGACGAATCATTTGATGGGGACGCTTTAAAATTTGAATAA60
120
180
225
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1373 [new locus tag: SAUSA300_RS07500 ]
- symbol: SAUSA300_1373
- description: ferredoxin
- length: 74
- theoretical pI: 3.12002
- theoretical MW: 7918.51
- GRAVY: -0.204054
⊟Function[edit | edit source]
- TIGRFAM: Central intermediary metabolism Sulfur metabolism sulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 10.7)
- TheSEED :
- [4Fe-4S] ferredoxin
- PFAM: 4Fe-4S (CL0344) Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 66.3)and 5 moreFer4_15; 4Fe-4S single cluster domain (PF13459; HMM-score: 48.3)Fer4; 4Fe-4S binding domain (PF00037; HMM-score: 14.7)Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 14.3)Fer4_4; 4Fe-4S binding domain (PF12800; HMM-score: 10.8)Fer4_2; 4Fe-4S binding domain (PF12797; HMM-score: 9.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.793
- Cytoplasmic Membrane Score: 0.1584
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0485
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.031143
- TAT(Tat/SPI): 0.000364
- LIPO(Sec/SPII): 0.002564
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAIDGCPTDSIKIADESFDGDALKFE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]