Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1429
- pan locus tag?: SAUPAN001308000
- symbol: SAUSA300_1429
- pan gene symbol?: —
- synonym:
- product: phiSLT ORF53-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1429
- symbol: SAUSA300_1429
- product: phiSLT ORF53-like protein
- replicon: chromosome
- strand: -
- coordinates: 1586510..1586605
- length: 96
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3913699 NCBI
- RefSeq: YP_494126 NCBI
- BioCyc:
- MicrobesOnline: 1292944 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGCCATTGCTGTACTTCACTACAGCATGGTCAATTGCGGGATTCGCAAGTATCGCAACA
TTCATATACTACAAAGAATACTTTTATGAAGAATAA60
96
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1429
- symbol: SAUSA300_1429
- description: phiSLT ORF53-like protein
- length: 31
- theoretical pI: 3.98003
- theoretical MW: 3737.25
- GRAVY: 0.448387
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF1270; Protein of unknown function (DUF1270) (PF06900; HMM-score: 72.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 5
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.072653
- TAT(Tat/SPI): 0.00463
- LIPO(Sec/SPII): 0.158333
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPLLYFTTAWSIAGFASIATFIYYKEYFYEE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.