From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1430 [new locus tag: SAUSA300_RS07805 ]
  • pan locus tag?: SAUPAN001309000
  • symbol: SAUSA300_1430
  • pan gene symbol?:
  • synonym:
  • product: phiSLT ORF 87-like protein DNA-binding protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1430 [new locus tag: SAUSA300_RS07805 ]
  • symbol: SAUSA300_1430
  • product: phiSLT ORF 87-like protein DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1586683..1586946
  • length: 264
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCCAAAAATCATAGTACCACCAACACCAGAAAACACATATAGAGGCGAAGAAAAATTT
    GTGAAAAAGTTATACGCAACACCTACACAAATCCATCAATTGTTTGGAGTATGTAGAAGT
    ACAGTATACAACTGGTTGAAATATTACCGCAAAGATAATTTAGGTGTAGAAAATTTATAC
    ATTGATTATTCACCAACAGGCACTCTGATTAATATTTCTAAATTGGAAGAGTATTTGATC
    AGAAAGCATAAAAAATGGTATTAG
    60
    120
    180
    240
    264


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1430 [new locus tag: SAUSA300_RS07805 ]
  • symbol: SAUSA300_1430
  • description: phiSLT ORF 87-like protein DNA-binding protein
  • length: 87
  • theoretical pI: 9.82716
  • theoretical MW: 10444.1
  • GRAVY: -0.611494

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Phage protein
  • PFAM:
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 30.7)
    and 9 more
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 21)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 20.2)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 19)
    HTH_Tnp_IS630; Transposase (PF01710; HMM-score: 17)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 16.6)
    HTH_OrfB_IS605; Helix-turn-helix domain (PF12323; HMM-score: 16)
    no clan defined DUF6570; Domain of unknown function (DUF6570) (PF20209; HMM-score: 16)
    HTH (CL0123) CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 14.9)
    no clan defined Xre-MbcA-ParS_M; Antitoxin Xre/MbcA/ParS-like, middle domain (PF23125; HMM-score: 13.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9387
    • Cytoplasmic Membrane Score: 0.0138
    • Cell wall & surface Score: 0.0016
    • Extracellular Score: 0.046
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009984
    • TAT(Tat/SPI): 0.000407
    • LIPO(Sec/SPII): 0.001073
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MPKIIVPPTPENTYRGEEKFVKKLYATPTQIHQLFGVCRSTVYNWLKYYRKDNLGVENLYIDYSPTGTLINISKLEEYLIRKHKKWY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]