Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1726 [new locus tag: SAUSA300_RS09440 ]
- pan locus tag?: SAUPAN004483000
- symbol: SAUSA300_1726
- pan gene symbol?: crcB2
- synonym:
- product: crcB family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1726 [new locus tag: SAUSA300_RS09440 ]
- symbol: SAUSA300_1726
- product: crcB family protein
- replicon: chromosome
- strand: +
- coordinates: 1909364..1909717
- length: 354
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914294 NCBI
- RefSeq: YP_494419 NCBI
- BioCyc: GH3C-1717 BioCyc
- MicrobesOnline: 1293241 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATATCAATCATTTTAGTCATGATTGGCGGCGGTTTTGGCGCAATTGCTAGAAGTGCC
ATTACTGATTATTTTAATCATAAATTTACTTCAAAGTTACCTATCGCAACATTGATAGTA
AATCTAGTTGGTAGTTTTTTAATTGGATTAACTATAGGCTTATCAATTTCAATCTCATGG
TTCCCTGCGTTCTTTGTTACCGGTTTTTTAGGTGGCTTAACAACTTTCTCAACGTTAGCC
AAAGAACTTACACTAATGATGACGCCAAAATTTAATATTAACCTTTTTCTCAATTATTCA
CTTTTACAATTCATCATTGGATTTATAGCTTGTTATATTGGCTATCATATTTAA60
120
180
240
300
354
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1726 [new locus tag: SAUSA300_RS09440 ]
- symbol: SAUSA300_1726
- description: crcB family protein
- length: 117
- theoretical pI: 9.58674
- theoretical MW: 12796.3
- GRAVY: 1.13932
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General protein CrcB (TIGR00494; HMM-score: 67.7)
- TheSEED :
- Fluoride ion exporter CrcB/FEX
- PFAM: DMT (CL0184) CRCB; CrcB-like protein, Camphor Resistance (CrcB) (PF02537; HMM-score: 75.2)and 2 moreno clan defined MlaE; Permease MlaE (PF02405; HMM-score: 9)BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 7.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005977
- TAT(Tat/SPI): 0.000266
- LIPO(Sec/SPII): 0.046671
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISWFPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]