From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1741
  • pan locus tag?: SAUPAN004517000
  • symbol: SAUSA300_1741
  • pan gene symbol?:
  • synonym:
  • product: putative lipoprotein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1741
  • symbol: SAUSA300_1741
  • product: putative lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 1924777..1924932
  • length: 156
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAAATTCAAAGCTATCGTTGCAATCACATTATCATTGTCACTATTAACTGCCTGTGGT
    GCTAATCAACATAAAGAAAATAGTAGTAAATCAAATGACACTAATAAAAAGACGCAACAA
    ACTGACAACACTACACAGTCAAATACAGAAAAGTAA
    60
    120
    156


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1741
  • symbol: SAUSA300_1741
  • description: putative lipoprotein
  • length: 51
  • theoretical pI: 10.0523
  • theoretical MW: 5570.17
  • GRAVY: -0.931373

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 20.6)
    and 1 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 13.3)
  • TheSEED  :
    • Hypothetical protein SAV1801
  • PFAM:
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.82
    • Extracellular Score: 9.13
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.8089
    • Cell wall & surface Score: 0.0022
    • Extracellular Score: 0.1889
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: SLLTACG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
    • SP(Sec/SPI): 0.00051
    • TAT(Tat/SPI): 0.000048
    • LIPO(Sec/SPII): 0.999323
    • Cleavage Site: CS pos: 18-19. LTA-CG. Pr: 0.9996
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKFKAIVAITLSLSLLTACGANQHKENSSKSNDTNKKTQQTDNTTQSNTEK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]