Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1741
- pan locus tag?: SAUPAN004517000
- symbol: SAUSA300_1741
- pan gene symbol?: —
- synonym:
- product: putative lipoprotein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1741
- symbol: SAUSA300_1741
- product: putative lipoprotein
- replicon: chromosome
- strand: +
- coordinates: 1924777..1924932
- length: 156
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3913807 NCBI
- RefSeq: YP_494433 NCBI
- BioCyc:
- MicrobesOnline: 1293256 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAATTCAAAGCTATCGTTGCAATCACATTATCATTGTCACTATTAACTGCCTGTGGT
GCTAATCAACATAAAGAAAATAGTAGTAAATCAAATGACACTAATAAAAAGACGCAACAA
ACTGACAACACTACACAGTCAAATACAGAAAAGTAA60
120
156
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1741
- symbol: SAUSA300_1741
- description: putative lipoprotein
- length: 51
- theoretical pI: 10.0523
- theoretical MW: 5570.17
- GRAVY: -0.931373
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 20.6)and 1 moreProtein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 13.3)
- TheSEED :
- Hypothetical protein SAV1801
- PFAM: LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.82
- Extracellular Score: 9.13
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.8089
- Cell wall & surface Score: 0.0022
- Extracellular Score: 0.1889
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: SLLTACG
- SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
- SP(Sec/SPI): 0.00051
- TAT(Tat/SPI): 0.000048
- LIPO(Sec/SPII): 0.999323
- Cleavage Site: CS pos: 18-19. LTA-CG. Pr: 0.9996
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFKAIVAITLSLSLLTACGANQHKENSSKSNDTNKKTQQTDNTTQSNTEK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]