PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_1741
• pan locus tag^?: SAUPAN004517000
• symbol: SAUSA300_1741
• pan gene symbol^?: —
• synonym:
• product: putative lipoprotein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_1741
• symbol: SAUSA300_1741
• product: putative lipoprotein
• replicon: chromosome
• strand: +
• coordinates: 1924777..1924932
• length: 156
• essential: unknown

⊟Accession numbers

• Gene ID: 3913807 NCBI
• RefSeq: YP_494433 NCBI
• BioCyc:
• MicrobesOnline: 1293256 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  
  ATGAAATTCAAAGCTATCGTTGCAATCACATTATCATTGTCACTATTAACTGCCTGTGGT
  GCTAATCAACATAAAGAAAATAGTAGTAAATCAAATGACACTAATAAAAAGACGCAACAA
  ACTGACAACACTACACAGTCAAATACAGAAAAGTAA
  60
  120
  156
  

⊟Protein

⊟General

• locus tag: SAUSA300_1741
• symbol: SAUSA300_1741
• description: putative lipoprotein
• length: 51
• theoretical pI: 10.0523
• theoretical MW: 5570.17
• GRAVY: -0.931373

⊟Function

• TIGRFAM:
  Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 20.6)
  and 1 more
  Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 13.3)
• TheSEED  :
  • Hypothetical protein SAV1801
• PFAM:
  no clan defined ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 13.1)
  LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.9)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Extracellular
  • Cytoplasmic Score: 0
  • Cytoplasmic Membrane Score: 0.05
  • Cellwall Score: 0.82
  • Extracellular Score: 9.13
  • Internal Helices: 0
• LocateP: Lipid anchored
  • Prediction by SwissProt Classification: Extracellular
  • Pathway Prediction: Sec-(SPII)
  • Intracellular possibility: -0.33
  • Signal peptide possibility: 1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: SLLTACG
• SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
  • SP(Sec/SPI): 0.00051
  • TAT(Tat/SPI): 0.000048
  • LIPO(Sec/SPII): 0.999323
  • Cleavage Site: CS pos: 18-19. LTA-CG. Pr: 0.9996
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 87161836 NCBI
• RefSeq: YP_494433 NCBI
• UniProt: A0A0H2XJH2 UniProt

⊟Protein sequence

• MKFKAIVAITLSLSLLTACGANQHKENSSKSNDTNKKTQQTDNTTQSNTEK

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SAUSA300_1741 > SAUSA300_1742 > SAUSA300_1743

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications