From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1790 [new locus tag: SAUSA300_RS09800 ]
  • pan locus tag?: SAUPAN004771000
  • symbol: prsA
  • pan gene symbol?: prsA
  • synonym:
  • product: foldase protein PrsA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1790 [new locus tag: SAUSA300_RS09800 ]
  • symbol: prsA
  • product: foldase protein PrsA
  • replicon: chromosome
  • strand: +
  • coordinates: 1971557..1972519
  • length: 963
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGAAGATGATAAACAAATTAATCGTTCCGGTAACAGCTAGTGCTTTATTATTAGGCGCT
    TGTGGCGCTAGTGCCACAGACTCTAAAGAAAATACATTAATTTCTTCTAAAGCTGGAGAC
    GTAACAGTTGCAGATACAATGAAAAAAATCGGTAAAGATCAAATTGCAAATGCATCATTT
    ACTGAAATGTTAAATAAAATTTTAGCTGATAAATATAAAAATAAAGTTAATGATAAGAAG
    ATTGACGAACAAATTGAAAAAATGCAAAAGCAATACGGCGGTAAAGATAAATTTGAAAAG
    GCCCTTCAACAGCAAGGTTTAACAGCCGATAAATATAAAGAAAATTTACGTACTGCTGCT
    TATCATAAAGAATTACTATCAGATAAAATTAAAATCTCTGATTCTGAAATTAAAGAAGAC
    AGCAAGAAAGCTTCACACATTTTAATTAAAGTTAAATCTAAGAAAAGCGACAAAGAAGGC
    TTAGATGATAAAGAAGCGAAACAAAAAGCTGAAGAAATTCAAAAAGAAGTTTCAAAAGAT
    CCAAGTAAATTTGGTGAAATCGCTAAAAAAGAATCAATGGATACTGGTTCAGCTAAAAAA
    GATGGCGAATTAGGTTATGTTCTTAAAGGACAAACTGATAAAGATTTTGAAAAAGCACTA
    TTTAAGCTTAAAGATGGTGAAGTATCAGAGGTTGTTAAATCAAGCTTTGGATATCATATT
    ATTAAAGCTGATAAACCAACAGACTTTAACAGTGAAAAACAAAGCCTGAAAGAAAAATTA
    GTCGATCAGAAAGTACAAAAAAATCCAAAATTATTGACTGATGCATACAAAGATCTATTA
    AAAGAATACGATGTTGACTTTAAAGATCGTGATATTAAATCAGTTGTCGAAGATAAAATC
    TTAAACCCTGAAAAACTTAAACAAGGTGGCGCACAAGGCGGACAATCCGGCATGAGCCAA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    963

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1790 [new locus tag: SAUSA300_RS09800 ]
  • symbol: PrsA
  • description: foldase protein PrsA
  • length: 320
  • theoretical pI: 9.6463
  • theoretical MW: 35637.5
  • GRAVY: -0.858125

Function[edit source | edit]

  • reaction:
    EC 5.2.1.8?  ExPASy
    Peptidylprolyl isomerasePeptidylproline (omega=180) = peptidylproline (omega=0)
  • TIGRFAM:
    MetabolismCentral intermediary metabolismNitrogen fixationnitrogen fixation protein NifM (TIGR02933; HMM-score: 49.5)
  • TheSEED:  
    Membrane TransportProtein translocation across cytoplasmic membraneEcsAB transporter affecting expression and secretion of secretory preproteins Foldase protein PrsA precursor (EC 5.2.1.8)
    and 2 more
    Protein MetabolismProtein foldingPeptidyl-prolyl cis-trans isomerase Foldase protein PrsA precursor (EC 5.2.1.8)
    CBSS-176279.3.peg.1262 Foldase clustered with pyrimidine conversion
  • PFAM:
    FKBP (CL0487) Rotamase; PPIC-type PPIASE domain (PF00639; HMM-score: 99.2)
    Rotamase_3; PPIC-type PPIASE domain (PF13616; HMM-score: 94.2)
    and 4 more
    Rotamase_2; PPIC-type PPIASE domain (PF13145; HMM-score: 32.9)
    Trigger_C (CL0262) SurA_N_3; SurA N-terminal domain (PF13624; HMM-score: 24.5)
    SurA_N; SurA N-terminal domain (PF09312; HMM-score: 16.2)
    HTH (CL0123) Fe_dep_repr_C; Iron dependent repressor, metal binding and dimerisation domain (PF02742; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: LLLGACG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 20 aa
    • SP(Sec/SPI): 0.01518
    • TAT(Tat/SPI): 0.000182
    • LIPO(Sec/SPII): 0.984206
    • Cleavage Site: CS pos: 20-21. LGA-CG. Pr: 0.9847
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKMINKLIVPVTASALLLGACGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQSGMSQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • prsA no polycistronic organisation predicted

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]