From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1943 [new locus tag: SAUSA300_RS10660 ]
  • pan locus tag?: SAUPAN001379000
  • symbol: SAUSA300_1943
  • pan gene symbol?: —
  • synonym:
  • product: phi77 ORF040-like protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1943 [new locus tag: SAUSA300_RS10660 ]
  • symbol: SAUSA300_1943
  • product: phi77 ORF040-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2109817..2110116
  • length: 300
  • essential: unknown

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGATGACTAAAGACGAACGCATACGATTCTATAAGTCTAAAGAATGGCAAACAACAAGA
    AAAAGAGTGCTAGAAAGAGATAATTATGAATGTCAACAATGTAAGAGAGACGGCAAGTTA
    ACGACATATGACAAAAGCAAGCGTAAGTCGTTGGATGTAGATCATATATTATCGCTAGAA
    CATCATCCGGAGTTTGCTCATGACTTAAACAATTTAGAAACACTGTGTATTAAATGTCAC
    AACAAAAAAGAAAAGAGATTTATAAAAAAAGAAAATAAATGGAAAGACGAAAAATGGTAA
    60
    120
    180
    240
    300

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_1943 [new locus tag: SAUSA300_RS10660 ]
  • symbol: SAUSA300_1943
  • description: phi77 ORF040-like protein
  • length: 99
  • theoretical pI: 9.9015
  • theoretical MW: 12328.1
  • GRAVY: -1.49899

⊟Function[edit | edit source]

  • TIGRFAM:
    decaheme c-type cytochrome, DmsE family (TIGR03508; HMM-score: 15.2)
    and 1 more
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 5.9)
  • TheSEED  :
    • Phage HNH endonuclease
  • PFAM:
    His-Me_finger (CL0263) HNH; HNH endonuclease (PF01844; HMM-score: 38.8)
    and 5 more
    Multiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 17.4)
    Zn_Beta_Ribbon (CL0167) zf-ISL3; zinc-finger of transposase IS204/IS1001/IS1096/IS1165 (PF14690; HMM-score: 16)
    Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 13.4)
    His-Me_finger (CL0263) HNH_5; HNH endonuclease (PF14279; HMM-score: 12.6)
    Multiheme_cytos (CL0317) Cytochrom_c3_2; Cytochrome c3 (PF14537; HMM-score: 12.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 0
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009156
    • TAT(Tat/SPI): 0.00065
    • LIPO(Sec/SPII): 0.004319
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MMTKDERIRFYKSKEWQTTRKRVLERDNYECQQCKRDGKLTTYDKSKRKSLDVDHILSLEHHPEFAHDLNNLETLCIKCHNKKEKRFIKKENKWKDEKW

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_1943&oldid=81130"