Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1948 [new locus tag: SAUSA300_RS10685 ]
- pan locus tag?: SAUPAN001384000
- symbol: SAUSA300_1948
- pan gene symbol?: —
- synonym:
- product: phi77 ORF069-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1948 [new locus tag: SAUSA300_RS10685 ]
- symbol: SAUSA300_1948
- product: phi77 ORF069-like protein
- replicon: chromosome
- strand: -
- coordinates: 2111521..2111727
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914997 NCBI
- RefSeq: YP_494599 NCBI
- BioCyc: see SAUSA300_RS10685
- MicrobesOnline: 1293463 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACACAATACTTAGTCACAACATTCAAAGATTCAACAGGACGTAAACATACACACATA
ACTAAAGCTAAGAGTAATCAAAGGTTTACAGTTGTTGAGGCAGAGAGTAAAGAAGAAGCG
AAAGAGAAGTACGAGAAACAAGTTAAAAGGGATGCAGTTATTAAAGTGGGTCAGTTGTTT
GAAAATATAAGGGAGTGTGGGAAATGA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1948 [new locus tag: SAUSA300_RS10685 ]
- symbol: SAUSA300_1948
- description: phi77 ORF069-like protein
- length: 68
- theoretical pI: 10.1426
- theoretical MW: 7917.99
- GRAVY: -1.00147
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage phi 11 orf26a protein homolog
- PFAM: no clan defined DUF1381; Protein of unknown function (DUF1381) (PF07129; HMM-score: 85.1)and 4 moreDUF658; Protein of unknown function (DUF658) (PF04936; HMM-score: 16.2)4H_Cytokine (CL0053) IL7; Interleukin 7 (PF01415; HMM-score: 14.4)no clan defined DUF7686; Domain of unknown function (DUF7686) (PF24735; HMM-score: 13.3)YhzD; YhzD-like protein (PF14120; HMM-score: 7.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9091
- Cytoplasmic Membrane Score: 0.0037
- Cell wall & surface Score: 0.0022
- Extracellular Score: 0.085
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007921
- TAT(Tat/SPI): 0.000706
- LIPO(Sec/SPII): 0.002761
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTQYLVTTFKDSTGRKHTHITKAKSNQRFTVVEAESKEEAKEKYEKQVKRDAVIKVGQLFENIRECGK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]