From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2070 [new locus tag: SAUSA300_RS11400 ]
  • pan locus tag?: SAUPAN005407000
  • symbol: SAUSA300_2070
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2070 [new locus tag: SAUSA300_RS11400 ]
  • symbol: SAUSA300_2070
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2231704..2232750
  • length: 1047
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    TTGGATACTAAAATTTGGGATGTTAGAGAATATAATGAAGATTTACAGCAATATCCTAAA
    ATTAATGAAATAAAAGACATTGTTTTAAACGGTGGTTTAATAGGTTTACCAACTGAAACA
    GTTTATGGACTTGCAGCAAATGCGACAGATGAAGAAGCTGTAGCTAAAATATATGAAGCT
    AAAGGCCGTCCATCTGACAATCCGCTTATTGTTCATATACACAGTAAAGGTCAATTAAAA
    GATTTTACATATACTTTGGATCCACGCGTAGAAAAGTTAATGCAGGCATTCTGGCCGGGC
    CCTATTTCGTTTATATTGCCGTTAAAGCTAGGCTATCTATGTCGAAAAGTTTCTGGAGGT
    TTATCATCAGTTGCTGTTAGAATGCCAAGCCATTCTGTAGGTAGACAATTATTACAAATC
    ATAAATGAACCTCTAGCTGCTCCAAGTGCTAATTTAAGTGGTAGACCTTCACCAACAACT
    TTCAATCATGTATATCAAGATTTGAATGGCCGTATCGATGGTATTGTTCAAGCTGAACAA
    AGTGAAGAAGGATTAGAAAGTACGGTTTTAGATTGCACATCTTTTCCTTATAAAATTGCA
    AGACCTGGTTCTATAACAGCAGCAATGATTACAGAAATACTTCCGAATAGTATCGCCCAT
    GCTGATTATAATGATACTGAACAGCCAATTGCACCAGGTATGAAGTATAAGCATTACTCA
    CCCAATACACCACTTACAATTATTACAGATATTGAGAGCAAAATTGGAAATGACGGTAAA
    GATTGGTCTTCTATAGCTTTTATTGTGCCGAGTAATAAGGTGGCGTTTATACCAAGTGAA
    GCGCAATTCATTCAATTATGTCAGGATGACAATGATGTTAAACAAGCAAGTCATAATCTT
    TATGATGTGTTACATTCACTTGATGAAAATGAAAATATTTCAGCGGCGTATATATACGGC
    TTTGAGCTGAATGATAATACAGAAGCAATTATGAATCGCATGTTAAAAGCTGCAGGTAAT
    CACATTATTAAAGGATGTGAACTATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1047

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2070 [new locus tag: SAUSA300_RS11400 ]
  • symbol: SAUSA300_2070
  • description: hypothetical protein
  • length: 348
  • theoretical pI: 4.80011
  • theoretical MW: 38445.3
  • GRAVY: -0.269253

Function[edit | edit source]

  • reaction:
    EC 2.7.7.87?  ExPASy
    L-threonylcarbamoyladenylate synthase L-threonine + ATP + HCO3(-) = L-threonylcarbamoyladenylate + diphosphate + H2O
  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family (TIGR00057; HMM-score: 194.5)
    and 1 more
    Genetic information processing Protein fate Protein modification and repair carbamoyltransferase HypF (TIGR00143; HMM-score: 27.4)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, Pigments Tetrapyrroles Experimental tye  Sua5 YciO YrdC YwlC family protein
    and 4 more
    RNA Metabolism RNA processing and modification t6A synthesis in bacteria  TsaC protein (YrdC-Sua5 domains) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA
    tRNA mods Archaea  TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA
    YrdC-YciO  TsaC protein (YrdC-Sua5 domains) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA
    YrdC-YciO-Sua5 and associated protein families  TsaC protein (YrdC-Sua5 domains) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA
  • PFAM:
    no clan defined Sua5_yciO_yrdC; Telomere recombination (PF01300; HMM-score: 179.4)
    and 1 more
    GT-B (CL0113) SUA5; Putative GTP-binding controlling metal-binding (PF03481; HMM-score: 76.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.041162
    • TAT(Tat/SPI): 0.011825
    • LIPO(Sec/SPII): 0.000612
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MDTKIWDVREYNEDLQQYPKINEIKDIVLNGGLIGLPTETVYGLAANATDEEAVAKIYEAKGRPSDNPLIVHIHSKGQLKDFTYTLDPRVEKLMQAFWPGPISFILPLKLGYLCRKVSGGLSSVAVRMPSHSVGRQLLQIINEPLAAPSANLSGRPSPTTFNHVYQDLNGRIDGIVQAEQSEEGLESTVLDCTSFPYKIARPGSITAAMITEILPNSIAHADYNDTEQPIAPGMKYKHYSPNTPLTIITDIESKIGNDGKDWSSIAFIVPSNKVAFIPSEAQFIQLCQDDNDVKQASHNLYDVLHSLDENENISAAYIYGFELNDNTEAIMNRMLKAAGNHIIKGCEL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]