From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00725 [old locus tag: SAUSA300_0138 ]
  • pan locus tag?: SAUPAN000948000
  • symbol: SAUSA300_RS00725
  • pan gene symbol?: deoD1
  • synonym:
  • product: purine-nucleoside phosphorylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS00725 [old locus tag: SAUSA300_0138 ]
  • symbol: SAUSA300_RS00725
  • product: purine-nucleoside phosphorylase
  • replicon: chromosome
  • strand: +
  • coordinates: 157077..157784
  • length: 708
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (157077..157784) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATCAACACCACACATTAAACCAATGAATGACGTCGAAATTGCAGAAACGGTTCTA
    TTGCCAGGAGATCCGTTAAGAGCTAAGTTCATTGCAGAAACTTATTTGGATGATGTGGAA
    CAGTTCAATACAGTGCGAAACATGTTTGGTTTTACCGGAACATATAAAGGTAAAAAAGTT
    TCTGTCATGGGTTCAGGTATGGGTATGCCATCTATTGGCATTTACTCTTATGAATTAATT
    CATACATTTGGTTGTAAAAAATTAATTCGCGTTGGCTCTTGTGGCGCGATGCAAGAAAAC
    ATTGATTTATATGATGTGATTATTGCACAAGGTGCCTCTACTGATTCAAATTACGTTCAA
    CAATATCAATTACCAGGTCATTTTGCGCCAATTGCTTCTTATCAATTATTAGAAAAAGCA
    GTTGAAACAGCACGTGACAAAGGTGTACGTCATCATGTAGGTAATGTGTTATCAAGTGAT
    ATTTTCTATAACGCGGATACAACAGCGAGTGAACGTTGGATGCGTATGGGTATTTTAGGT
    GTAGAAATGGAATCAGCTGCATTATACATGAATGCAATTTACGCTGGTGTCGAAGCATTA
    GGTGTGTTCACAGTGAGCGATCATTTAATTCATGAAACGTCAACAACACCTGAGGAAAGG
    GAACGTGCATTTACAGATATGATTGAAATTGCACTGTCATTGGTGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    708

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS00725 [old locus tag: SAUSA300_0138 ]
  • symbol: SAUSA300_RS00725
  • description: purine-nucleoside phosphorylase
  • length: 235
  • theoretical pI: 4.9407
  • theoretical MW: 25991.5
  • GRAVY: -0.0493617

Function[edit | edit source]

  • reaction:
    EC 2.4.2.1?  ExPASy
    Purine-nucleoside phosphorylase Purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate Purine deoxynucleoside + phosphate = purine + 2'-deoxy-alpha-D-ribose 1-phosphate
  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides purine nucleoside phosphorylase (TIGR00107; EC 2.4.2.1; HMM-score: 297.1)
    and 7 more
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine phosphorylase (TIGR01718; EC 2.4.2.3; HMM-score: 117.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides MTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 30.2)
    Metabolism Central intermediary metabolism Other MTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 30.2)
    futalosine hydrolase (TIGR03664; EC 3.2.2.26; HMM-score: 29.5)
    hopanoid-associated phosphorylase (TIGR03468; HMM-score: 25.6)
    putative AMP nucleosidase (TIGR01721; HMM-score: 24)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine phosphorylase (TIGR01719; EC 2.4.2.3; HMM-score: 20.5)
  • TheSEED:
  • PFAM:
    PUP (CL0408) PNP_UDP_1; Phosphorylase superfamily (PF01048; HMM-score: 136)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017472
    • TAT(Tat/SPI): 0.000888
    • LIPO(Sec/SPII): 0.000873
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446766036 NCBI
  • RefSeq: WP_000843292 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKSTPHIKPMNDVEIAETVLLPGDPLRAKFIAETYLDDVEQFNTVRNMFGFTGTYKGKKVSVMGSGMGMPSIGIYSYELIHTFGCKKLIRVGSCGAMQENIDLYDVIIAQGASTDSNYVQQYQLPGHFAPIASYQLLEKAVETARDKGVRHHVGNVLSSDIFYNADTTASERWMRMGILGVEMESAALYMNAIYAGVEALGVFTVSDHLIHETSTTPEERERAFTDMIEIALSLV

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]