Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS01505 [old locus tag: SAUSA300_0281 ]
- pan locus tag?: SAUPAN001178000
- symbol: SAUSA300_RS01505
- pan gene symbol?: esaB
- synonym:
- product: type VII secretion protein EsaB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS01505 [old locus tag: SAUSA300_0281 ]
- symbol: SAUSA300_RS01505
- product: type VII secretion protein EsaB
- replicon: chromosome
- strand: +
- coordinates: 334318..334599
- length: 282
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (334318..334599) NCBI
- BioCyc: SAUSA300_RS01505 BioCyc
- MicrobesOnline: see SAUSA300_0281
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGTCATTTTTTCAATTCATAAAGGGAGACGAACGAAAAATGAATCAGCACGTAAAAGTA
ACATTTGATTTTACTAATTATAATTACGGCACATATGACTTAGCAGTACCAGCATATTTA
CCGATAAAAAACTTAATAGCTTTAGTATTGGATAGTTTGGACATTTCAATATTTGATGTC
AATACACAAATTAAAGTGATGACGAAAGGTCAATTACTTGTTGAAAATGATCGACTCATT
GATTATCAAATCGCTGATGGAGATATTTTGAAGTTACTATAG60
120
180
240
282
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS01505 [old locus tag: SAUSA300_0281 ]
- symbol: SAUSA300_RS01505
- description: type VII secretion protein EsaB
- length: 93
- theoretical pI: 4.65437
- theoretical MW: 10735.4
- GRAVY: 0.0860215
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0281
- PFAM: Ubiquitin (CL0072) YukD; WXG100 protein secretion system (Wss), protein YukD (PF08817; HMM-score: 45.3)and 4 moreubiquitin; Ubiquitin family (PF00240; HMM-score: 17.1)Rad60-SLD; Ubiquitin-2 like Rad60 SUMO-like (PF11976; HMM-score: 15.1)DMT (CL0184) Nuc_sug_transp; Nucleotide-sugar transporter (PF04142; HMM-score: 14.8)no clan defined DUF5488; Family of unknown function (DUF5488) (PF17590; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9631
- Cytoplasmic Membrane Score: 0.0221
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0146
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003357
- TAT(Tat/SPI): 0.00014
- LIPO(Sec/SPII): 0.000289
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: see SAUSA300_0281
- RefSeq: WP_011446982 NCBI
- UniProt: see SAUSA300_0281
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSFFQFIKGDERKMNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]