From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS02650 [old locus tag: SAUSA300_0494 ]
  • pan locus tag?: SAUPAN002258000
  • symbol: SAUSA300_RS02650
  • pan gene symbol?: folK
  • synonym:
  • product: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS02650 [old locus tag: SAUSA300_0494 ]
  • symbol: SAUSA300_RS02650
  • product: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
  • replicon: chromosome
  • strand: +
  • coordinates: 553137..553613
  • length: 477
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (553137..553613) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGATTCAAGCATACTTAGGATTAGGTAGTAATATTGGTGATAGAGAAAGCCAGTTAAAC
    GATGCTATAAAGATTTTGAATGAATATGATGGTATTAACGTATCTAATATTTCTCCGATT
    TATGAAACAGCACCAGTTGGGTATACTGAGCAACCTAACTTTTTAAATTTGTGTGTTGAA
    ATTCAAACAACACTCACAGTATTACAACTGTTGGAATGTTGTTTGAAGACAGAAGAATGT
    TTACACCGTATTAGAAAGGAACGATGGGGTCCTAGAACTTTAGATGTGGATATTTTGTTG
    TATGGAGAAGAAATGATAGATTTACCAAAACTGTCGGTGCCACATCCGAGAATGAATGAA
    CGTGCATTTGTTTTAATCCCATTAAATGATATAGCAGCAAATGTCGTAGAACCACGTTCG
    AAATTGAAAGTGAAAGATTTAGTTTTTGTCGATGACAGTGTAAAGAGATATAAATAA
    60
    120
    180
    240
    300
    360
    420
    477

Protein[edit | edit source]

Protein Data Bank: 5ETQ
Protein Data Bank: 5ETR
Protein Data Bank: 5ETS
Protein Data Bank: 5ETT
Protein Data Bank: 5ETV

General[edit | edit source]

  • locus tag: SAUSA300_RS02650 [old locus tag: SAUSA300_0494 ]
  • symbol: SAUSA300_RS02650
  • description: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
  • length: 158
  • theoretical pI: 4.84673
  • theoretical MW: 18028.8
  • GRAVY: -0.149367

Function[edit | edit source]

  • reaction:
    EC 2.7.6.3?  ExPASy
    2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase ATP + 6-hydroxymethyl-7,8-dihydropterin = AMP + 6-hydroxymethyl-7,8-dihydropterin diphosphate
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Folic acid 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (TIGR01498; EC 2.7.6.3; HMM-score: 150.3)
  • TheSEED:
  • PFAM:
    no clan defined HPPK; 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) (PF01288; HMM-score: 125.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SAUSA300_RS03530LysR family transcriptional regulator  [1] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006796
    • TAT(Tat/SPI): 0.000391
    • LIPO(Sec/SPII): 0.001991
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446536370 NCBI
  • RefSeq: WP_000613716 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]