From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS03995
  • pan locus tag?:
  • symbol: SAUSA300_RS03995
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS03995
  • symbol: SAUSA300_RS03995
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 823440..823676
  • length: 237
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (823440..823676) NCBI
  • BioCyc: SAUSA300_RS03995 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATATGGTATTTTAGCGCAGCATTCTTTCCATGTGTCTTGGTAGTATTATTTAGTGTA
    ATAACAAGAAGTAAATGGGTCGGTACTATTCTGACATTAATTTTAATTGGTGCCTCAATC
    TATAAAGAGTATTTCCATAACGAGTGGATTATTTTTATTGATGTAGTGTCATTATTAGCT
    GGTTATTTAATTATAGATCAACTCGAATTTCATAAACATCAAGATGAAGATCGCTAA
    60
    120
    180
    237


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS03995
  • symbol: SAUSA300_RS03995
  • description: hypothetical protein
  • length: 78
  • theoretical pI: 5.49047
  • theoretical MW: 9197.76
  • GRAVY: 0.752564

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined DUF2198; Uncharacterized protein conserved in bacteria (DUF2198) (PF09964; HMM-score: 112.8)
    and 5 more
    TgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 17)
    Peptidase_MA (CL0126) Peptidase_M50B; Peptidase M50B-like (PF13398; HMM-score: 14.9)
    no clan defined DUF7670; Domain of unknown function (DUF7670) (PF24709; HMM-score: 13.9)
    LiaI-LiaF-TM (CL0800) LiaF-TM; LiaF transmembrane domain (PF22570; HMM-score: 11.6)
    no clan defined Spore_YhaL; Sporulation protein YhaL (PF14147; HMM-score: 8.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.9974
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0025
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003292
    • TAT(Tat/SPI): 0.000759
    • LIPO(Sec/SPII): 0.012477
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI: 446561073 NCBI
  • RefSeq: WP_000638419 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MIWYFSAAFFPCVLVVLFSVITRSKWVGTILTLILIGASIYKEYFHNEWIIFIDVVSLLAGYLIIDQLEFHKHQDEDR

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]