COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_RS04210
• pan locus tag^?:
• symbol: SAUSA300_RS04210
• pan gene symbol^?: —
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_RS04210
• symbol: SAUSA300_RS04210
• product: hypothetical protein
• replicon: chromosome
• strand: -
• coordinates: 869363..869551
• length: 189
• essential: unknown

⊟Accession numbers

• Location: NC_007793 (869363..869551) NCBI
• BioCyc: SAUSA300_RS04210 BioCyc
• MicrobesOnline:

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
  TTTATACTCGTATTAATGAAAAAAACTAGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
  TTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
  GTGCTATAA
  60
  120
  180
  189
  

⊟Protein

⊟General

• locus tag: SAUSA300_RS04210
• symbol: SAUSA300_RS04210
• description: hypothetical protein
• length: 62
• theoretical pI: 10.0084
• theoretical MW: 7172.78
• GRAVY: 1.45968

⊟Function

• TIGRFAM:
• TheSEED:
• PFAM:
  no clan defined BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 16.3)
  GPCR_A (CL0192) Bac_rhodopsin; Bacteriorhodopsin-like protein (PF01036; HMM-score: 15)
  no clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 13.5)
  Intg_mem_TP0381; Integral membrane protein (intg_mem_TP0381) (PF09529; HMM-score: 13.4)
  and 17 more
  DUF4051; Protein of unknown function (DUF4051) (PF13260; HMM-score: 12.2)
  PGG; Domain of unknown function (PF13962; HMM-score: 12.1)
  SLC3A2_N; Solute carrier family 3 member 2 N-terminus (PF16028; HMM-score: 12.1)
  DUF3742; Protein of unknown function (DUF3742) (PF12553; HMM-score: 12)
  SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 11.9)
  Glucos_trans_II; Glucosyl transferase GtrII (PF14264; HMM-score: 11.7)
  MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 11)
  TEX29; Testis-expressed sequence 29 protein (PF15839; HMM-score: 10.8)
  DUF3671; Protein of unknown function (PF12420; HMM-score: 10.5)
  Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 9.9)
  no clan defined CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 9.7)
  NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 9.6)
  no clan defined DUF2208; Predicted membrane protein (DUF2208) (PF09973; HMM-score: 9.4)
  DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 8.7)
  Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 8.4)
  no clan defined Tmemb_55A; Transmembrane protein 55A (PF09788; HMM-score: 6)
  DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 4.9)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.32
  • Cytoplasmic Membrane Score: 9.55
  • Cellwall Score: 0.12
  • Extracellular Score: 0.01
  • Internal Helices: 2
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.009265
  • TAT(Tat/SPI): 0.000756
  • LIPO(Sec/SPII): 0.123344
• predicted transmembrane helices (TMHMM): 2

⊟Accession numbers

• GI: 445974223 NCBI
• RefSeq: WP_000052078 NCBI
• UniProt:

⊟Protein sequence

• MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications