From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS04260 [old locus tag: SAUSA300_0789 ]
  • pan locus tag?: SAUPAN002819000
  • symbol: SAUSA300_RS04260
  • pan gene symbol?: trxP
  • synonym:
  • product: thiol reductase thioredoxin

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS04260 [old locus tag: SAUSA300_0789 ]
  • symbol: SAUSA300_RS04260
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 875219..875539
  • length: 321
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAATCAATCAAAAGTAATGAATCATTTAAATCTGTAATTAATAGCGATACACCTGTA
    ATTGTTAAATTTGAGGCAGGATGGTGCCCAGACTGTCGTGCTATGGATTTATGGATTGAC
    CCAATCGTAGAACAATATAATGATTACCAATGGTATACTGTTAATCGTGATGAATTAGAA
    GATGTAGTTGTTGAAAATGAAGTTATGGGTATCCCTAGCTTGCTAGTATTTAAAAACGGC
    GATAAAATTGCACACCTTCATTCAGCAAATGCTAAGTCACCTGAACAAGTTGAATCATTT
    TTAGCAGAAACTTTTAAATAA
    60
    120
    180
    240
    300
    321


⊟Protein[edit | edit source]

Protein Data Bank: 4RUV

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS04260 [old locus tag: SAUSA300_0789 ]
  • symbol: SAUSA300_RS04260
  • description: thiol reductase thioredoxin
  • length: 106
  • theoretical pI: 4.22853
  • theoretical MW: 12140.6
  • GRAVY: -0.314151

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 56.4)
    and 3 more
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 34)
    protein disulfide isomerase (TIGR01130; HMM-score: 24.9)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 13.8)
  • TheSEED: see SAUSA300_0789
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 62.1)
    and 7 more
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 20.1)
    Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 18.3)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 16.4)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 14.5)
    HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 13.3)
    TXD17-like_Trx; Thioredoxin domain-containing protein 17-like, thioredoxin domain (PF06110; HMM-score: 13.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9871
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0125
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007747
    • TAT(Tat/SPI): 0.000221
    • LIPO(Sec/SPII): 0.001056
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]