From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS04260 [old locus tag: SAUSA300_0789 ]
  • pan locus tag?: SAUPAN002819000
  • symbol: SAUSA300_RS04260
  • pan gene symbol?:
  • synonym:
  • product: thiol reductase thioredoxin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS04260 [old locus tag: SAUSA300_0789 ]
  • symbol: SAUSA300_RS04260
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 875219..875539
  • length: 321
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (875219..875539) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAATCAATCAAAAGTAATGAATCATTTAAATCTGTAATTAATAGCGATACACCTGTA
    ATTGTTAAATTTGAGGCAGGATGGTGCCCAGACTGTCGTGCTATGGATTTATGGATTGAC
    CCAATCGTAGAACAATATAATGATTACCAATGGTATACTGTTAATCGTGATGAATTAGAA
    GATGTAGTTGTTGAAAATGAAGTTATGGGTATCCCTAGCTTGCTAGTATTTAAAAACGGC
    GATAAAATTGCACACCTTCATTCAGCAAATGCTAAGTCACCTGAACAAGTTGAATCATTT
    TTAGCAGAAACTTTTAAATAA
    60
    120
    180
    240
    300
    321

Protein[edit | edit source]

Protein Data Bank: 4RUV

General[edit | edit source]

  • locus tag: SAUSA300_RS04260 [old locus tag: SAUSA300_0789 ]
  • symbol: SAUSA300_RS04260
  • description: thiol reductase thioredoxin
  • length: 106
  • theoretical pI: 4.22853
  • theoretical MW: 12140.6
  • GRAVY: -0.314151

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 56.4)
    and 3 more
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 34)
    protein disulfide isomerase (TIGR01130; HMM-score: 24.9)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 13.8)
  • TheSEED:
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 62.8)
    and 7 more
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 18.2)
    Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 17.3)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 17.2)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 15.3)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 14.8)
    Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 14.2)
    DUF953; Eukaryotic protein of unknown function (DUF953) (PF06110; HMM-score: 13.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007747
    • TAT(Tat/SPI): 0.000221
    • LIPO(Sec/SPII): 0.001056
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447113439 NCBI
  • RefSeq: WP_001190695 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNGDKIAHLHSANAKSPEQVESFLAETFK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]