Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS04265 [old locus tag: SAUSA300_0790 ]
- pan locus tag?: SAUPAN002820000
- symbol: SAUSA300_RS04265
- pan gene symbol?: —
- synonym:
- product: arsenate reductase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS04265 [old locus tag: SAUSA300_0790 ]
- symbol: SAUSA300_RS04265
- product: arsenate reductase
- replicon: chromosome
- strand: +
- coordinates: 875683..876039
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (875683..876039) NCBI
- BioCyc: SAUSA300_RS04265 BioCyc
- MicrobesOnline: see SAUSA300_0790
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTAAATTTTACCAATATAAGAATTGTACAACTTGTAAAAAGGCAGCAAAGTTTTTA
GATGAATATGGCGTAAGTTATGAACCAATTGATATCGTTCAACATACACCTACAATAAAT
GAATTTAAAACAATAATTGCAAATACAGGCGTAGAAATTAATAAATTGTTTAATACACAC
GGCGCGAAATATCGTGAGCTTGATTTGAAAAATAAATTACAAACTTTATCAGATGATGAA
AAGTTAGAGTTGTTATCATCTGATGGTATGTTAGTAAAGCGTCCTCTAGCAGTAATGGGC
GATAAGATAACATTAGGATTTAAAGAAGATCAATATAAAGAGACTTGGTTAGCGTAA60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS04265 [old locus tag: SAUSA300_0790 ]
- symbol: SAUSA300_RS04265
- description: arsenate reductase
- length: 118
- theoretical pI: 7.40662
- theoretical MW: 13599.6
- GRAVY: -0.445763
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 155)and 7 moreglutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 40.2)Cellular processes Detoxification arsenate reductase (glutaredoxin) (TIGR00014; EC 1.20.4.1; HMM-score: 39.4)glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 32.5)Unknown function General nitrogenase-associated protein (TIGR01616; HMM-score: 30.5)glutaredoxin-like protein (TIGR02200; HMM-score: 24.3)Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 22.5)glutaredoxin-family domain (TIGR02190; HMM-score: 12.7)
- TheSEED: see SAUSA300_0790
- PFAM: Thioredoxin (CL0172) ArsC; ArsC family (PF03960; HMM-score: 72.9)and 4 moreGlutaredoxin; Glutaredoxin (PF00462; HMM-score: 32.7)no clan defined IMPa_helical; Immunomodulating metalloprotease helical domain (PF18642; HMM-score: 15.2)RNase_3_N; Ribonuclease III N-terminal domain (PF18497; HMM-score: 14.2)Thioredoxin (CL0172) Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9869
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0114
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006247
- TAT(Tat/SPI): 0.000081
- LIPO(Sec/SPII): 0.001464
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446512094 NCBI
- RefSeq: WP_000589549 NCBI
- UniProt: see SAUSA300_0790
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]