Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS04360 [old locus tag: SAUSA300_0808 ]
- pan locus tag?: SAUPAN002854000
- symbol: SAUSA300_RS04360
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS04360 [old locus tag: SAUSA300_0808 ]
- symbol: SAUSA300_RS04360
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 887065..887313
- length: 249
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (887065..887313) NCBI
- BioCyc: SAUSA300_RS04360 BioCyc
- MicrobesOnline: see SAUSA300_0808
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATTGGGAAATTAAAAATTTAATGTGTGATTTAAAGATATTGAAAGAAAAGTTTGAG
GATTTAAAGGATAATCATGGCTCGCATTTTGAAGATTTATATCTACATGAGCCAAATCAT
ACCTTAAATAAAGACGATGCTATTAAAGAAGGATTTTCATATCATGAGAGACGTATTCAC
AATGATCAAATGTTTGATGCATTAGAAAAAGCGTCATCTTTCGCCGACCAAAGCCAAGAT
AACGCATAA60
120
180
240
249
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS04360 [old locus tag: SAUSA300_0808 ]
- symbol: SAUSA300_RS04360
- description: hypothetical protein
- length: 82
- theoretical pI: 4.87901
- theoretical MW: 9751.69
- GRAVY: -1.07805
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0808
- PFAM: no clan defined DUF1474; Protein of unknown function (DUF1474) (PF07342; HMM-score: 42.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.771
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.2279
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002247
- TAT(Tat/SPI): 0.000157
- LIPO(Sec/SPII): 0.000356
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447026703 NCBI
- RefSeq: WP_001103959 NCBI
- UniProt: see SAUSA300_0808
⊟Protein sequence[edit | edit source]
- MNWEIKNLMCDLKILKEKFEDLKDNHGSHFEDLYLHEPNHTLNKDDAIKEGFSYHERRIHNDQMFDALEKASSFADQSQDNA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]