From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS05215 [old locus tag: SAUSA300_0970 ]
  • pan locus tag?: SAUPAN003281000
  • symbol: SAUSA300_RS05215
  • pan gene symbol?: purQ
  • synonym:
  • product: phosphoribosylformylglycinamidine synthase subunit PurQ

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS05215 [old locus tag: SAUSA300_0970 ]
  • symbol: SAUSA300_RS05215
  • product: phosphoribosylformylglycinamidine synthase subunit PurQ
  • replicon: chromosome
  • strand: +
  • coordinates: 1062013..1062684
  • length: 672
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1062013..1062684) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATTTGCGGTTCTTGTTTTTCCAGGTTCGAATTGTGATAGAGACATGTTTAATGCT
    GCTATTAAAAGTGGTGTTGAAGCGGAATATGTAGATTATAGAGAAACATCACTAAGTGGA
    TTTGATGGCGTACTTATTCCTGGTGGATTTTCATTCGGGGATTACTTAAGATCTGGGGCA
    ATGGCTAGTGTAGCGCCGATTATTTCGGAAGTTAAACGTCTTGCAGCTGAAGGTAAGCCA
    GTATTAGGTGTTTGTAATGGGTTTCAAATTTTAACTGAAATAGGCTTATTACCTGGTGCA
    TTATTGCATAACGATTCACATTTATTTATTAGTAGAAATGAAGAGTTAGAAATAGTGAAT
    AATCAAACGGCATTTACAAATCTTTATGAACAAGGTGAAAAAGTTATATATCCTGTAGCT
    CACGGTGAAGGTCATTATTATTGTACTGATGAAATATATCAACAATTAAAAGCTAACAAT
    CAAATTATTCTGAAATATGTGAATAATCCGAACGGTTCATATGATGATATTGCAGGAATT
    GTTAACGAAAAAGGCAATGTATGTGGCATGATGCCACATCCTGAAAGAGCTTTAGAAACG
    TTGTTAGGTACTGATAGTGGTGTGAAATTATTTGAAGCGATGGTAAAAAGTTGGAGGGAA
    CAACATGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    672

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS05215 [old locus tag: SAUSA300_0970 ]
  • symbol: SAUSA300_RS05215
  • description: phosphoribosylformylglycinamidine synthase subunit PurQ
  • length: 223
  • theoretical pI: 4.69597
  • theoretical MW: 24526.7
  • GRAVY: -0.108969

Function[edit | edit source]

  • reaction:
    EC 3.5.1.2?  ExPASy
    Glutaminase L-glutamine + H2O = L-glutamate + NH3
    EC 6.3.5.3?  ExPASy
    Phosphoribosylformylglycinamidine synthase ATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 325.8)
    and 10 more
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase (TIGR01857; EC 6.3.5.3; HMM-score: 83.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase (TIGR01735; EC 6.3.5.3; HMM-score: 76.2)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides intracellular protease, PfpI family (TIGR01382; HMM-score: 25.8)
    Metabolism Amino acid biosynthesis Histidine family imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 25.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pyridoxine pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 21.8)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis CTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 17.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobyric acid synthase CobQ (TIGR00313; EC 6.3.5.10; HMM-score: 17.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis GMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 16.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis carbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 13.2)
    aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 10.2)
  • TheSEED:
  • PFAM:
    Glutaminase_I (CL0014) GATase_5; CobB/CobQ-like glutamine amidotransferase domain (PF13507; HMM-score: 155.3)
    and 5 more
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 32.7)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 30)
    DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 29)
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 16.4)
    SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 13.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.045141
    • TAT(Tat/SPI): 0.000764
    • LIPO(Sec/SPII): 0.006095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446589453 NCBI
  • RefSeq: WP_000666799 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]