From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS05795 [old locus tag: SAUSA300_1068 ]
  • pan locus tag?: SAUPAN003441000
  • symbol: SAUSA300_RS05795
  • pan gene symbol?: psmβ2
  • synonym: psmB2
  • product: hemolytic protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS05795 [old locus tag: SAUSA300_1068 ]
  • symbol: SAUSA300_RS05795
  • product: hemolytic protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1168589..1168723
  • length: 135
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGACTGGACTAGCAGAAGCAATCGCAAATACTGTGCAAGCTGCACAACAACATGATAGT
    GTGAAATTAGGCACAAGTATCGTAGACATCGTTGCTAACGGTGTGGGTTTACTAGGTAAA
    TTATTTGGATTCTAA
    60
    120
    135


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS05795 [old locus tag: SAUSA300_1068 ]
  • symbol: SAUSA300_RS05795
  • description: hemolytic protein
  • length: 44
  • theoretical pI: 5.51933
  • theoretical MW: 4456.1
  • GRAVY: 0.606818

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_1068
  • PFAM:
    no clan defined PSMbeta; Phenol-soluble modulin beta protein (PF05480; HMM-score: 82.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0051
    • Cytoplasmic Membrane Score: 0.0519
    • Cell wall & surface Score: 0.0012
    • Extracellular Score: 0.9418
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.171987
    • TAT(Tat/SPI): 0.00759
    • LIPO(Sec/SPII): 0.014954
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Rong Wang, Kevin R Braughton, Dorothee Kretschmer, Thanh-Huy L Bach, Shu Y Queck, Min Li, Adam D Kennedy, David W Dorward, Seymour J Klebanoff, Andreas Peschel, Frank R DeLeo, Michael Otto
Identification of novel cytolytic peptides as key virulence determinants for community-associated MRSA.
Nat Med: 2007, 13(12);1510-4
[PubMed:17994102] [WorldCat.org] [DOI] (I p)
Shu Y Queck, Max Jameson-Lee, Amer E Villaruz, Thanh-Huy L Bach, Burhan A Khan, Daniel E Sturdevant, Stacey M Ricklefs, Min Li, Michael Otto
RNAIII-independent target gene control by the agr quorum-sensing system: insight into the evolution of virulence regulation in Staphylococcus aureus.
Mol Cell: 2008, 32(1);150-8
[PubMed:18851841] [WorldCat.org] [DOI] (I p)
Michael Otto
Staphylococcus aureus toxins.
Curr Opin Microbiol: 2014, 17;32-7
[PubMed:24581690] [WorldCat.org] [DOI] (I p)