From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS06155 [old locus tag: SAUSA300_1137 ]
  • pan locus tag?: SAUPAN003536000
  • symbol: SAUSA300_RS06155
  • pan gene symbol?: rnhB
  • synonym:
  • product: ribonuclease HII

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS06155 [old locus tag: SAUSA300_1137 ]
  • symbol: SAUSA300_RS06155
  • product: ribonuclease HII
  • replicon: chromosome
  • strand: +
  • coordinates: 1245956..1246723
  • length: 768
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1245956..1246723) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACGCTAACAATTAAAGAAGTTACGCAGTTGATTAATGCGGTTAATACAATAGAAGAA
    TTAGAAAATCATGAATGCTTTTTAGATGAGCGAAAAGGTGTTCAAAATGCCATAGCTAGG
    CGCAGAAAAGCGTTAGAAAAAGAACAAGCTTTAAAAGAAAAGTATGTTGAAATGACTTAC
    TTTGAAAATGAAATATTAAAAGAGCATCCTAATGCTATTATTTGTGGGATTGATGAAGTT
    GGAAGAGGACCTTTAGCAGGTCCAGTCGTTGCATGCGCAACAATTTTAAATTCAAATCAC
    AATTATTTGGGCCTTGATGACTCGAAAAAAGTACCTGTTACGAAACGTCTAGAATTAAAT
    GAAGCACTAAAAAATGAAGTTACTGCTTTTGCATATGGGATCGCGACAGCTGAAGAAATA
    GATGAATTTAATATTTATAAAGCTACTCAAATCGCCATGCAGCGAGCTATTGATGGATTA
    TCAGTACAACCAACGCATTTATTGATAGACGCGATGACGCTTGATAATGCACTGCCTCAA
    GTATCTTTAATCAAGGGTGATGCAAGAAGTGTGTCCATTGCAGCTGCAAGTATCATGGCA
    AAGGTTTTTCGTGATGATTATATGACACAGTTATCTAAAGATTATCCTGAATATGGTTTT
    GAAAAAAACGCGGGTTACGGTACCAAACAACATTTACTAGCAATCGATGATATTGGCATT
    ATGAAAGAGCATAGAAAAAGCTTTGAACCTATAAAATCGTTACTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    768

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS06155 [old locus tag: SAUSA300_1137 ]
  • symbol: SAUSA300_RS06155
  • description: ribonuclease HII
  • length: 255
  • theoretical pI: 5.22942
  • theoretical MW: 28512.5
  • GRAVY: -0.247843

Function[edit | edit source]

  • reaction:
    EC 3.1.26.4?  ExPASy
    Ribonuclease H Endonucleolytic cleavage to 5'-phosphomonoester
  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair ribonuclease HII (TIGR00729; EC 3.1.26.4; HMM-score: 74.5)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair ribonuclease HIII (TIGR00716; EC 3.1.26.4; HMM-score: 25.2)
  • TheSEED:
  • PFAM:
    RNase_H (CL0219) RNase_HII; Ribonuclease HII (PF01351; HMM-score: 120.5)
    and 1 more
    no clan defined DUF3983; Protein of unknown function (DUF3983) (PF13137; HMM-score: 13.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+, Mn2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00157
    • TAT(Tat/SPI): 0.000106
    • LIPO(Sec/SPII): 0.000209
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446098539 NCBI
  • RefSeq: WP_000176394 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTYFENEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYLGLDDSKKVPVTKRLELNEALKNEVTAFAYGIATAEEIDEFNIYKATQIAMQRAIDGLSVQPTHLLIDAMTLDNALPQVSLIKGDARSVSIAAASIMAKVFRDDYMTQLSKDYPEYGFEKNAGYGTKQHLLAIDDIGIMKEHRKSFEPIKSLL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]