From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS06525 [old locus tag: SAUSA300_1206 ]
  • pan locus tag?: SAUPAN003641000
  • symbol: SAUSA300_RS06525
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS06525 [old locus tag: SAUSA300_1206 ]
  • symbol: SAUSA300_RS06525
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1328390..1328641
  • length: 252
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCTTACATTAATAAAATTGAAAGAAGATGAACAGGTTATAATATATGAATATATACCT
    GAAGATGATATAAGTAACGGTAAAGGTTCAGTAACTTTTAATAAAAAAGATGCAGAGGTT
    ATAGATTTCTCATTATCTGAAATAGAAAATGAAGAATATTTTATGTTATATCGTAATAAG
    TCTTTTTCTGTAGTAAGAGACTTTATCGAGAAGCAAGAATTTCCCGAAAATTATAAAATA
    GCATGGTATTAA
    60
    120
    180
    240
    252


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS06525 [old locus tag: SAUSA300_1206 ]
  • symbol: SAUSA300_RS06525
  • description: hypothetical protein
  • length: 83
  • theoretical pI: 4.15325
  • theoretical MW: 9988.19
  • GRAVY: -0.504819

Function[edit | edit source]

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7535
    • Cytoplasmic Membrane Score: 0.0498
    • Cell wall & surface Score: 0.0015
    • Extracellular Score: 0.1952
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002868
    • TAT(Tat/SPI): 0.000229
    • LIPO(Sec/SPII): 0.00045
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLTLIKLKEDEQVIIYEYIPEDDISNGKGSVTFNKKDAEVIDFSLSEIENEEYFMLYRNKSFSVVRDFIEKQEFPENYKIAWY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]