Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS06570 [old locus tag: SAUSA300_1211 ]
- pan locus tag?: SAUPAN003655000
- symbol: SAUSA300_RS06570
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS06570 [old locus tag: SAUSA300_1211 ]
- symbol: SAUSA300_RS06570
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1331047..1331241
- length: 195
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1331047..1331241) NCBI
- BioCyc: SAUSA300_RS06570 BioCyc
- MicrobesOnline: see SAUSA300_1211
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGAGAATTGAAGATGCATATCGTAAAGATGTTATTATCACGCTTTTGAATAATGAAGAA
TACGAAGGGTTTGTAACTGACTATGAAAATGAATTCGAGAGCGAAACAGGAAATCTTGTT
GTAGATATACAGACTGATTTTGCTGTTTATTCGTTTGATGAAACTGAGATAAAAAGTATT
AGATTATTAAAATAA60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS06570 [old locus tag: SAUSA300_1211 ]
- symbol: SAUSA300_RS06570
- description: hypothetical protein
- length: 64
- theoretical pI: 3.84276
- theoretical MW: 7573.31
- GRAVY: -0.420312
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1211
- PFAM: no clan defined Mre11_C; Mre11 C-terminal Rad50-binding domain (PF22226; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8527
- Cytoplasmic Membrane Score: 0.0261
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.1207
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008486
- TAT(Tat/SPI): 0.000169
- LIPO(Sec/SPII): 0.000758
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447140039 NCBI
- RefSeq: WP_001217295 NCBI
- UniProt: see SAUSA300_1211
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRIEDAYRKDVIITLLNNEEYEGFVTDYENEFESETGNLVVDIQTDFAVYSFDETEIKSIRLLK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]