Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS06665 [old locus tag: SAUSA300_1230 ]
- pan locus tag?: SAUPAN003704000
- symbol: SAUSA300_RS06665
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS06665 [old locus tag: SAUSA300_1230 ]
- symbol: SAUSA300_RS06665
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1347807..1348121
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1347807..1348121) NCBI
- BioCyc: SAUSA300_RS06665 BioCyc
- MicrobesOnline: see SAUSA300_1230
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTGGACAAACAAATTTATTTGATGATGTACTAAAGCAAGATGAAAGATTTGTTATT
GTAGTTCAAGCATTAGAAGAAAAGAACGGACAATTATTAAAGAGAACTTTAAGGGAATAT
CCCGGTTTAAACCATAAACAAATGAATGATTTATTTATGCACTTAAAGGAATTATTTTCC
GAAGAATCATTTGCTGAAAACCAATCAGCGTTCAGTATTACAGTTTATACAAATTTAGAT
TATACTGCTGACCAAATATATGCTCATGTAAAACGTTTCAGAGGTAAGCATGACTGGACA
CAAACAGCTAAATAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS06665 [old locus tag: SAUSA300_1230 ]
- symbol: SAUSA300_RS06665
- description: hypothetical protein
- length: 104
- theoretical pI: 6.51691
- theoretical MW: 12283.8
- GRAVY: -0.618269
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1230
- PFAM: P-loop_NTPase (CL0023) DnaB_C; DnaB-like helicase C terminal domain (PF03796; HMM-score: 14.5)TPR (CL0020) CNOT1_HEAT; CCR4-NOT transcription complex subunit 1 HEAT repeat (PF16418; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7764
- Cytoplasmic Membrane Score: 0.1739
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0494
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002221
- TAT(Tat/SPI): 0.0003
- LIPO(Sec/SPII): 0.000392
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446502344 NCBI
- RefSeq: WP_000580198 NCBI
- UniProt: see SAUSA300_1230
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIGQTNLFDDVLKQDERFVIVVQALEEKNGQLLKRTLREYPGLNHKQMNDLFMHLKELFSEESFAENQSAFSITVYTNLDYTADQIYAHVKRFRGKHDWTQTAK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]