From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS07360 [old locus tag: SAUSA300_1350 ]
  • pan locus tag?: SAUPAN003919000
  • symbol: SAUSA300_RS07360
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS07360 [old locus tag: SAUSA300_1350 ]
  • symbol: SAUSA300_RS07360
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1517567..1517884
  • length: 318
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAATCAATGGTAGAAATGCAACGTGAAGTTGATGAATATATTGGACAATTTAAAACA
    GGATATTTTTCACCATTAGCTAACTTAGCTAGATTGACTGAAGAAGTGGGCGAACTTGCA
    CGTGAAATAAATCATACCTATGGTGAAAAAAAGAAGAAAGATTCAGAGGAAGCAAATACG
    ATTAAAGCAGAATTAGGTGATAATTTATTTGTGTTGTTATGTTTAGCGAATTCAATGGGA
    ATAGATATGACAGAGAGCTTTAATGAAACAATGGAAAAGTTTAATACAAGAGATAAAAAT
    CGATTCGAAAGAAAGTGA
    60
    120
    180
    240
    300
    318


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS07360 [old locus tag: SAUSA300_1350 ]
  • symbol: SAUSA300_RS07360
  • description: hypothetical protein
  • length: 105
  • theoretical pI: 4.81549
  • theoretical MW: 12194.7
  • GRAVY: -0.766667

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General MazG family protein (TIGR00444; HMM-score: 25.4)
  • TheSEED: see SAUSA300_1350
  • PFAM:
    MazG (CL0231) MazG; MazG nucleotide pyrophosphohydrolase domain (PF03819; HMM-score: 70.5)
    and 4 more
    dUTPase_2; dUTPase (PF08761; HMM-score: 26.5)
    PRA-PH; Phosphoribosyl-ATP pyrophosphohydrolase (PF01503; HMM-score: 17.6)
    MazG-like; MazG-like family (PF12643; HMM-score: 15.8)
    no clan defined Phage_CP76; Phage regulatory protein CII (CP76) (PF06892; HMM-score: 15.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9868
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0128
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008515
    • TAT(Tat/SPI): 0.000596
    • LIPO(Sec/SPII): 0.001447
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKSMVEMQREVDEYIGQFKTGYFSPLANLARLTEEVGELAREINHTYGEKKKKDSEEANTIKAELGDNLFVLLCLANSMGIDMTESFNETMEKFNTRDKNRFERK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]