From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS07715 [old locus tag: SAUSA300_1414 ]
  • pan locus tag?: SAUPAN001477000
  • symbol: SAUSA300_RS07715
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS07715 [old locus tag: SAUSA300_1414 ]
  • symbol: SAUSA300_RS07715
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1578618..1578854
  • length: 237
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATTAACATACCTAAAATGAAATTCCCGAAAAAGTACACTGAAATAATCAAAAAATAT
    AAAAATAAAGCACCTGAAGAAAAGGCTAAGATTGAAGATGATTTTATTAAAGAAATTAAA
    GATAAAGACAGTGAATTTTACAGTCCTACGATGGCTAATATGAATGAATATGAATTAAGG
    GCTATGTTAAGAATGATGCCTAGTTTAATTGATACTGGAGATGACAATGATGATTAA
    60
    120
    180
    237


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS07715 [old locus tag: SAUSA300_1414 ]
  • symbol: SAUSA300_RS07715
  • description: hypothetical protein
  • length: 78
  • theoretical pI: 4.89007
  • theoretical MW: 9284.69
  • GRAVY: -1.00641

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General modD protein (TIGR01334; HMM-score: 12.6)
  • TheSEED: see SAUSA300_1414
  • PFAM:
    no clan defined DUF7366; Domain of unknown function (DUF7366) (PF24074; HMM-score: 160.8)
    and 3 more
    Rpn3_C; Proteasome regulatory subunit C-terminal (PF08375; HMM-score: 14.6)
    EsxAB (CL0352) LXG; LXG domain of WXG superfamily (PF04740; HMM-score: 13.9)
    no clan defined DUF2115; Uncharacterized protein conserved in archaea (DUF2115) (PF09888; HMM-score: 13.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8437
    • Cytoplasmic Membrane Score: 0.0097
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.1464
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004908
    • TAT(Tat/SPI): 0.00034
    • LIPO(Sec/SPII): 0.000719
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MINIPKMKFPKKYTEIIKKYKNKAPEEKAKIEDDFIKEIKDKDSEFYSPTMANMNEYELRAMLRMMPSLIDTGDDNDD

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]