Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07715 [old locus tag: SAUSA300_1414 ]
- pan locus tag?: SAUPAN001477000
- symbol: SAUSA300_RS07715
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07715 [old locus tag: SAUSA300_1414 ]
- symbol: SAUSA300_RS07715
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1578618..1578854
- length: 237
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1578618..1578854) NCBI
- BioCyc: SAUSA300_RS07715 BioCyc
- MicrobesOnline: see SAUSA300_1414
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTAACATACCTAAAATGAAATTCCCGAAAAAGTACACTGAAATAATCAAAAAATAT
AAAAATAAAGCACCTGAAGAAAAGGCTAAGATTGAAGATGATTTTATTAAAGAAATTAAA
GATAAAGACAGTGAATTTTACAGTCCTACGATGGCTAATATGAATGAATATGAATTAAGG
GCTATGTTAAGAATGATGCCTAGTTTAATTGATACTGGAGATGACAATGATGATTAA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07715 [old locus tag: SAUSA300_1414 ]
- symbol: SAUSA300_RS07715
- description: hypothetical protein
- length: 78
- theoretical pI: 4.89007
- theoretical MW: 9284.69
- GRAVY: -1.00641
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General modD protein (TIGR01334; HMM-score: 12.6)
- TheSEED: see SAUSA300_1414
- PFAM: no clan defined DUF7366; Domain of unknown function (DUF7366) (PF24074; HMM-score: 160.8)and 3 moreRpn3_C; Proteasome regulatory subunit C-terminal (PF08375; HMM-score: 14.6)EsxAB (CL0352) LXG; LXG domain of WXG superfamily (PF04740; HMM-score: 13.9)no clan defined DUF2115; Uncharacterized protein conserved in archaea (DUF2115) (PF09888; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8437
- Cytoplasmic Membrane Score: 0.0097
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.1464
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004908
- TAT(Tat/SPI): 0.00034
- LIPO(Sec/SPII): 0.000719
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446530929 NCBI
- RefSeq: WP_000608275 NCBI
- UniProt: see SAUSA300_1414
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MINIPKMKFPKKYTEIIKKYKNKAPEEKAKIEDDFIKEIKDKDSEFYSPTMANMNEYELRAMLRMMPSLIDTGDDNDD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]