PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_RS07820 [old locus tag: SAUSA300_1433 ]
• pan locus tag^?: SAUPAN001313000
• symbol: SAUSA300_RS07820
• pan gene symbol^?: —
• synonym:
• product: transcriptional regulator

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_RS07820 [old locus tag: SAUSA300_1433 ]
• symbol: SAUSA300_RS07820
• product: transcriptional regulator
• replicon: chromosome
• strand: -
• coordinates: 1587729..1587920
• length: 192
• essential: unknown

⊟Accession numbers

• Location: NC_007793 (1587729..1587920) NCBI
• BioCyc: SAUSA300_RS07820 BioCyc
• MicrobesOnline: see SAUSA300_1433

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  ATGCCGGAACAATTATCCGTAAGAAAATGGAGACTTGTAAGGGACTTGAAACAGCAAGAA
  GTAGCAGATATATTGGGCGTCAATGCAAAGACAGTTGGTCATTGGGAAAAGGATGACACT
  AATTTAAGTAATGTTACAGTTTACGCTTTAGCAAAGTTATATGATATTGAGGTAGACCAG
  ATAAAGGTCTAA
  60
  120
  180
  192
  

⊟Protein

⊟General

• locus tag: SAUSA300_RS07820 [old locus tag: SAUSA300_1433 ]
• symbol: SAUSA300_RS07820
• description: transcriptional regulator
• length: 63
• theoretical pI: 5.78693
• theoretical MW: 7281.3
• GRAVY: -0.366667

⊟Function

• TIGRFAM:
  putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 24)
  Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 22.3)
  and 1 more
  RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.8)
• TheSEED: see SAUSA300_1433
• PFAM:
  HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 37.4)
  and 13 more
  HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 27.4)
  HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 22.8)
  HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.2)
  MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 16.5)
  Phage_terminase; Phage terminase small subunit (PF10668; HMM-score: 16.3)
  HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 16)
  MerR; MerR family regulatory protein (PF00376; HMM-score: 15.7)
  HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 14.9)
  HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.6)
  Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 14.2)
  DUF1870; Domain of unknown function (DUF1870) (PF08965; HMM-score: 13.7)
  Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 13.1)
  Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 12.7)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: unknown (no significant prediction)
  • Cytoplasmic Score: 2.5
  • Cytoplasmic Membrane Score: 2.5
  • Cellwall Score: 2.5
  • Extracellular Score: 2.5
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.003676
  • TAT(Tat/SPI): 0.000258
  • LIPO(Sec/SPII): 0.000615
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 447037804 NCBI
• RefSeq: WP_001115060 NCBI
• UniProt: see SAUSA300_1433

⊟Protein sequence

• MPEQLSVRKWRLVRDLKQQEVADILGVNAKTVGHWEKDDTNLSNVTVYALAKLYDIEVDQIKV

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications