Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS08225 [old locus tag: SAUSA300_1506 ]
- pan locus tag?: SAUPAN004125000
- symbol: SAUSA300_RS08225
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS08225 [old locus tag: SAUSA300_1506 ]
- symbol: SAUSA300_RS08225
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1657759..1658088
- length: 330
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1657759..1658088) NCBI
- BioCyc: SAUSA300_RS08225 BioCyc
- MicrobesOnline: see SAUSA300_1506
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCTATTGTTGATGTGGTTGTTATTCCAGTTGGAACGGAAGGTCCGAGTGTTAGTAAA
TATATTGCAGATATTCAGAAAAAACTTCAAGAATATAAAGCAATGGGTAAAATTGATTTT
CAATTAACACCAATGAATACTCTAATTGAAGGTGAATTAAGCGATGTATTAGAAGTTGTG
CAAGTGATACATGAATTACCTTTTGATAAAGGTTTAAGTAGAGTTTGTACAAATATCCGT
ATTGATGACCGACGAGACAAATCTAGAAAAATGAATGATAAACTAACATCAGTACAAAAA
CATTTAGAAAATAGTGGTGAAAACCTATGA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS08225 [old locus tag: SAUSA300_1506 ]
- symbol: SAUSA300_RS08225
- description: hypothetical protein
- length: 109
- theoretical pI: 5.75172
- theoretical MW: 12282.1
- GRAVY: -0.301835
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General uncharacterized protein, MTH1187 family (TIGR00106; HMM-score: 113.6)
- TheSEED: see SAUSA300_1506
- PFAM: MTH1187-YkoF (CL0360) Thiamine_BP; Thiamine-binding protein (PF01910; HMM-score: 107.5)and 1 moreno clan defined DUF2732; Protein of unknown function (DUF2732) (PF10809; HMM-score: 17.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9928
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0069
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003994
- TAT(Tat/SPI): 0.000143
- LIPO(Sec/SPII): 0.000378
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446941615 NCBI
- RefSeq: WP_001018871 NCBI
- UniProt: see SAUSA300_1506
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAIVDVVVIPVGTEGPSVSKYIADIQKKLQEYKAMGKIDFQLTPMNTLIEGELSDVLEVVQVIHELPFDKGLSRVCTNIRIDDRRDKSRKMNDKLTSVQKHLENSGENL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]