From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS08615 [old locus tag: SAUSA300_1581 ]
  • pan locus tag?: SAUPAN004226000
  • symbol: SAUSA300_RS08615
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS08615 [old locus tag: SAUSA300_1581 ]
  • symbol: SAUSA300_RS08615
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1732461..1732607
  • length: 147
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAGTTTTATGGATAAAGCTAAAGACGCAGTAGAAAAATTTAAAAATAGCGATAATGAA
    CAAGTTAAAAATGTAAAAGATAAGATAAATGAATATACAGGATCGAATAACGAAGAGAAA
    AAAGAAAATGAAGATAAAGAGAAATAA
    60
    120
    147

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS08615 [old locus tag: SAUSA300_1581 ]
  • symbol: SAUSA300_RS08615
  • description: hypothetical protein
  • length: 48
  • theoretical pI: 4.78677
  • theoretical MW: 5655.14
  • GRAVY: -1.89792

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_1581
  • PFAM:
    no clan defined CdiI_2; CdiI immunity protein (PF18593; HMM-score: 13.7)
    YtxH; YtxH-like protein (PF12732; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8931
    • Cytoplasmic Membrane Score: 0.0002
    • Cell wall & surface Score: 0.0052
    • Extracellular Score: 0.1015
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.104333
    • TAT(Tat/SPI): 0.008115
    • LIPO(Sec/SPII): 0.018002
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSFMDKAKDAVEKFKNSDNEQVKNVKDKINEYTGSNNEEKKENEDKEK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]