From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS08870 [old locus tag: SAUSA300_1626 ]
  • pan locus tag?: SAUPAN004298000
  • symbol: SAUSA300_RS08870
  • pan gene symbol?: rpmI
  • synonym:
  • product: 50S ribosomal protein L35

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS08870 [old locus tag: SAUSA300_1626 ]
  • symbol: SAUSA300_RS08870
  • product: 50S ribosomal protein L35
  • replicon: chromosome
  • strand: -
  • coordinates: 1779649..1779849
  • length: 201
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1779649..1779849) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCCAAAAATGAAAACTCACCGCGGAGCAGCTAAACGTGTTAAAAGAACTGCTTCAGGT
    CAATTAAAACGTTCAAGAGCTTTCACATCTCACTTATTCGCAAACAAGAGCACTAAACAA
    AAACGTCAATTACGTAAAGCTAGATTAGTGTCTAAGAGCGATATGAAACGTGTAAAACAA
    TTATTAGCATACAAAAAATAA
    60
    120
    180
    201

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SAUSA300_RS08870 [old locus tag: SAUSA300_1626 ]
  • symbol: SAUSA300_RS08870
  • description: 50S ribosomal protein L35
  • length: 66
  • theoretical pI: 12.8298
  • theoretical MW: 7697.22
  • GRAVY: -1.12879

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL35 (TIGR00001; HMM-score: 87.4)
  • TheSEED:
  • PFAM:
    no clan defined Ribosomal_L35p; Ribosomal protein L35 (PF01632; HMM-score: 87.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013842
    • TAT(Tat/SPI): 0.010368
    • LIPO(Sec/SPII): 0.005105
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447048284 NCBI
  • RefSeq: WP_001125540 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQLLAYKK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]