From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS09075 [old locus tag: SAUSA300_1663 ]
  • pan locus tag?: SAUPAN004369000
  • symbol: SAUSA300_RS09075
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS09075 [old locus tag: SAUSA300_1663 ]
  • symbol: SAUSA300_RS09075
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1828621..1828761
  • length: 141
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1828621..1828761) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    GTGATTATGCTTTTTTCACTACTTATATTAATTAAAACAACACATTTGATTACGTTTATC
    TTTAAACAATTGCTATTTATATTTATTGTCCCTTTCATTTATCCATATAAAAAAGAAGCT
    AGACAACGTATCGTTGGCTAA
    60
    120
    141

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS09075 [old locus tag: SAUSA300_1663 ]
  • symbol: SAUSA300_RS09075
  • description: hypothetical protein
  • length: 46
  • theoretical pI: 10.9001
  • theoretical MW: 5558.93
  • GRAVY: 1.09783

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan defined Reticulon; Reticulon (PF02453; HMM-score: 16.2)
    and 1 more
    DUF2393; Protein of unknown function (DUF2393) (PF09624; HMM-score: 10.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014584
    • TAT(Tat/SPI): 0.001084
    • LIPO(Sec/SPII): 0.022103
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001789981 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIMLFSLLILIKTTHLITFIFKQLLFIFIVPFIYPYKKEARQRIVG

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]