From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS09150 [old locus tag: SAUSA300_1676 ]
  • pan locus tag?: SAUPAN004390000
  • symbol: SAUSA300_RS09150
  • pan gene symbol?: sgtA
  • synonym:
  • product: transglycosylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS09150 [old locus tag: SAUSA300_1676 ]
  • symbol: SAUSA300_RS09150
  • product: transglycosylase
  • replicon: chromosome
  • strand: +
  • coordinates: 1843108..1844013
  • length: 906
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1843108..1844013) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGACGAATCAAGACAACAATCATCAATTGAATCATCGTATATATCATTTTGAAAAGATA
    TATAAAGCTATCAAACATGTCATTGTTTTTATATTTATGATTTTCATTGCCATCGTTGCT
    ATCGCTGTGATTGCGATGTCTTTATATTTTCATCATTTAACTAAAACGTCCGACTCATTA
    TCAGATGATGCTTTAATAAAAAAAGTTCGACAAATACCTGGCGATGAATTATTAGATCAT
    AATAACAAAAATTTATTATATGAGTATAACCATTCTCAAAACTCACTCATTATAGGCCCT
    AAAACATCAAGTCCAAATGTCATTAAAGCATTAACGTCATCTGAAGACACTTTATTTTAT
    AAACATGATGGCATCTTACCAAAGGCGATTTTAAGAGCAATGATACAAGATATTTTTAAT
    ACTGATCAAAGTTCAGGTGGTAGCACAATTACACAACAACTTGTTAAAAATCAAGTTCTT
    ACCAACGAAAAAACATATAGTAGAAAAGCAAATGAACTTCGCCTAGCAATTAGATTAGAA
    CACCTACTCTCAAAAGATGAAATTATATATACATATTTAAATATAGTTCCCTTCGGTAGA
    GATTATAATGGCGCTAATATTTCCGGAATTGCATCCGCTTCATATAGTCTATTTGGTATT
    CCACCAAAAGATTTATCAATTGCACAATCTGCATACCTTATCGGTTTGTTGCAAAGCCCA
    TATGGCTATACACCCTACGAAAAAGATGGAACGTTAAAATCGGATAAAGATTTGAAATAT
    AGTATTCAAAGACAACATTATGTATTAAAGCGTATGTTAATCGAAGATCAAATCACTGAA
    AAAGAATACAACGACGCATTAAAATATGATATTAAATCACATTTGTTAAATCGAAAAAAG
    CGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    906

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS09150 [old locus tag: SAUSA300_1676 ]
  • symbol: SAUSA300_RS09150
  • description: transglycosylase
  • length: 301
  • theoretical pI: 9.50571
  • theoretical MW: 34526.3
  • GRAVY: -0.341196

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan penicillin-binding protein, 1A family (TIGR02074; HMM-score: 172.3)
    and 3 more
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan penicillin-binding protein 1C (TIGR02073; HMM-score: 136.6)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan penicillin-binding protein 1B (TIGR02071; HMM-score: 126.7)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan monofunctional biosynthetic peptidoglycan transglycosylase (TIGR02070; EC 2.4.2.-; HMM-score: 96)
  • TheSEED:
  • PFAM:
    Lysozyme (CL0037) Transgly; Transglycosylase (PF00912; HMM-score: 184.6)
    and 2 more
    no clan defined PspB; Phage shock protein B (PF06667; HMM-score: 11.6)
    E-set (CL0159) Arch_flagellin; Archaebacterial flagellin (PF01917; HMM-score: 10.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002378
    • TAT(Tat/SPI): 0.000201
    • LIPO(Sec/SPII): 0.000807
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 446106515 NCBI
  • RefSeq: WP_000184370 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MTNQDNNHQLNHRIYHFEKIYKAIKHVIVFIFMIFIAIVAIAVIAMSLYFHHLTKTSDSLSDDALIKKVRQIPGDELLDHNNKNLLYEYNHSQNSLIIGPKTSSPNVIKALTSSEDTLFYKHDGILPKAILRAMIQDIFNTDQSSGGSTITQQLVKNQVLTNEKTYSRKANELRLAIRLEHLLSKDEIIYTYLNIVPFGRDYNGANISGIASASYSLFGIPPKDLSIAQSAYLIGLLQSPYGYTPYEKDGTLKSDKDLKYSIQRQHYVLKRMLIEDQITEKEYNDALKYDIKSHLLNRKKR

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]